Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166EL72

Protein Details
Accession A0A166EL72   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-93DPQSWRAPLHRRGRRRRTSVWRIFSGKPGTKKRRCSPRRRSAQKRKLBasic
NLS Segment(s)
PositionSequence
54-93PLHRRGRRRRTSVWRIFSGKPGTKKRRCSPRRRSAQKRKL
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MASQLLSPPETLTESLANSQSTPCSSTDRLQAIYPAKRSFGPSIPFDPQSWRAPLHRRGRRRRTSVWRIFSGKPGTKKRRCSPRRRSAQKRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.17
5 0.15
6 0.16
7 0.15
8 0.14
9 0.15
10 0.14
11 0.17
12 0.2
13 0.22
14 0.27
15 0.28
16 0.28
17 0.27
18 0.3
19 0.31
20 0.32
21 0.34
22 0.28
23 0.27
24 0.26
25 0.29
26 0.27
27 0.26
28 0.25
29 0.24
30 0.27
31 0.29
32 0.29
33 0.26
34 0.27
35 0.26
36 0.25
37 0.24
38 0.22
39 0.24
40 0.3
41 0.38
42 0.45
43 0.5
44 0.57
45 0.67
46 0.76
47 0.81
48 0.82
49 0.83
50 0.83
51 0.86
52 0.85
53 0.81
54 0.77
55 0.72
56 0.66
57 0.63
58 0.62
59 0.57
60 0.56
61 0.61
62 0.65
63 0.68
64 0.77
65 0.8
66 0.82
67 0.86
68 0.88
69 0.89
70 0.89
71 0.92
72 0.93
73 0.95