Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166TFC4

Protein Details
Accession A0A166TFC4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-101RWTVQYNKCSRRSPRARPPWMSGRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
Amino Acid Sequences LRHNFKKAIDNSQKVGGKAAAKRAIVNTTADTLGRISYRVPAAARERAAVDLPLRRVSVTAGSAVTGIPKEPSGRYPRWTVQYNKCSRRSPRARPPWMSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.41
4 0.37
5 0.35
6 0.4
7 0.37
8 0.34
9 0.35
10 0.35
11 0.34
12 0.29
13 0.28
14 0.21
15 0.18
16 0.18
17 0.16
18 0.14
19 0.12
20 0.11
21 0.1
22 0.09
23 0.07
24 0.1
25 0.1
26 0.11
27 0.11
28 0.15
29 0.18
30 0.22
31 0.22
32 0.2
33 0.2
34 0.19
35 0.19
36 0.15
37 0.13
38 0.12
39 0.13
40 0.14
41 0.13
42 0.12
43 0.12
44 0.12
45 0.13
46 0.1
47 0.1
48 0.08
49 0.08
50 0.09
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.16
60 0.22
61 0.26
62 0.29
63 0.35
64 0.4
65 0.45
66 0.5
67 0.53
68 0.56
69 0.63
70 0.7
71 0.72
72 0.74
73 0.76
74 0.76
75 0.79
76 0.79
77 0.79
78 0.81
79 0.83
80 0.86
81 0.84