Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166I2L5

Protein Details
Accession A0A166I2L5   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
712-740NSPLILPDPTHRNRRRPRRKESRTPFEEAHydrophilic
NLS Segment(s)
PositionSequence
508-517PRPPGGGRGG
533-581TGPPPPNGAAPRAGPPPPQGGAPAPRPPPAGAPVAGAGRGAYKGVPPPR
723-733RNRRRPRRKES
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR036053  PABP-dom  
IPR006515  PABP_1234  
IPR002004  PABP_HYD  
IPR034364  PABP_RRM1  
IPR035979  RBD_domain_sf  
IPR045305  RRM2_I_PABPs  
IPR000504  RRM_dom  
IPR003954  RRM_dom_euk  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
GO:0006417  P:regulation of translation  
Pfam View protein in Pfam  
PF00658  PABP  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS51309  PABC  
PS50102  RRM  
CDD cd12378  RRM1_I_PABPs  
cd12379  RRM2_I_PABPs  
cd12380  RRM3_I_PABPs  
cd12381  RRM4_I_PABPs  
Amino Acid Sequences MSSPTIEAAAPAPETAPLPPSAAPYNPPAPQSSVAPSPSASLYVGELDPTVTEAMLFEIFNMIGPVASIRVCRDAVTRRSLGYAYVNYLNTNDGERALEQLNYSLIKNRACRIMWSQRDPALRKTGQGNIFIKNLDEQIDNKALHDTFAAFGNVLSCKVATDERGESKGYGFVHYETAEAADTAIKAVNGMLLNDKKVYVGHHISRKERQSKIDEQKAAFTNLYIKNVDTEVTQDEFEALFVKFGPVTSALISVDEEGKSKGFGFVNYEDHEHAAQAVDELHDTELNGKKLFVSRAQKKAEREEELRRSYEQAKMEKMSKYQGVNLYIKNLEDDVDDEKLRGEFEPYGSVTSCKVMRDEKGTSKGFGFVCFSSPDEATKAVAEMNNKMIGSKPLYVSLAQRREVRRQQLESQIAQRNQIRMQQAAAAGLPAGYINGPMYYPPGPGGFPPQAGRGMMPYGQPGPGMMPPRPRYPPQNGQGMPMPGPYPQGPPQGYGMPGGGFQRGGGPPRPPGGGRGGPGSSPTNPNVPIPRATGPPPPNGAAPRAGPPPPQGGAPAPRPPPAGAPVAGAGRGAYKGVPPPRAAPAGGAPPAAGAPEVPGAPNITAAALANASPMEQKQMLGEVIYMKIANAQPELAGKITGMLLEMDNAELLHLLEAPDAMNSKVNEALIVLHEFAKDDAAAEAAAAAAAAAPAALCVQYPTEDSLATLTVNSPLILPDPTHRNRRRPRRKESRTPFEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.14
6 0.15
7 0.19
8 0.21
9 0.22
10 0.24
11 0.27
12 0.32
13 0.33
14 0.34
15 0.33
16 0.33
17 0.34
18 0.35
19 0.33
20 0.33
21 0.32
22 0.31
23 0.28
24 0.26
25 0.25
26 0.23
27 0.18
28 0.13
29 0.13
30 0.15
31 0.14
32 0.12
33 0.12
34 0.11
35 0.1
36 0.11
37 0.1
38 0.07
39 0.07
40 0.06
41 0.08
42 0.09
43 0.08
44 0.07
45 0.08
46 0.08
47 0.09
48 0.09
49 0.07
50 0.06
51 0.06
52 0.07
53 0.06
54 0.08
55 0.09
56 0.1
57 0.14
58 0.15
59 0.16
60 0.22
61 0.29
62 0.34
63 0.41
64 0.4
65 0.37
66 0.4
67 0.39
68 0.35
69 0.31
70 0.28
71 0.25
72 0.28
73 0.27
74 0.25
75 0.26
76 0.25
77 0.2
78 0.2
79 0.16
80 0.12
81 0.13
82 0.13
83 0.16
84 0.16
85 0.16
86 0.14
87 0.14
88 0.16
89 0.15
90 0.16
91 0.19
92 0.22
93 0.26
94 0.29
95 0.32
96 0.36
97 0.36
98 0.4
99 0.42
100 0.49
101 0.52
102 0.55
103 0.57
104 0.56
105 0.63
106 0.62
107 0.59
108 0.58
109 0.5
110 0.47
111 0.46
112 0.48
113 0.44
114 0.49
115 0.45
116 0.39
117 0.4
118 0.37
119 0.34
120 0.27
121 0.24
122 0.18
123 0.17
124 0.15
125 0.19
126 0.24
127 0.23
128 0.22
129 0.25
130 0.22
131 0.21
132 0.21
133 0.16
134 0.12
135 0.13
136 0.13
137 0.09
138 0.09
139 0.11
140 0.11
141 0.1
142 0.1
143 0.08
144 0.08
145 0.1
146 0.11
147 0.11
148 0.15
149 0.19
150 0.22
151 0.24
152 0.25
153 0.23
154 0.23
155 0.25
156 0.22
157 0.19
158 0.17
159 0.16
160 0.17
161 0.17
162 0.16
163 0.12
164 0.12
165 0.11
166 0.09
167 0.08
168 0.07
169 0.06
170 0.07
171 0.07
172 0.06
173 0.06
174 0.06
175 0.08
176 0.08
177 0.08
178 0.14
179 0.15
180 0.16
181 0.17
182 0.17
183 0.14
184 0.15
185 0.16
186 0.17
187 0.22
188 0.28
189 0.34
190 0.4
191 0.45
192 0.52
193 0.59
194 0.6
195 0.58
196 0.58
197 0.58
198 0.64
199 0.68
200 0.7
201 0.66
202 0.58
203 0.6
204 0.55
205 0.51
206 0.4
207 0.3
208 0.29
209 0.26
210 0.28
211 0.23
212 0.21
213 0.2
214 0.2
215 0.2
216 0.12
217 0.12
218 0.12
219 0.12
220 0.12
221 0.11
222 0.11
223 0.11
224 0.11
225 0.1
226 0.07
227 0.06
228 0.06
229 0.07
230 0.06
231 0.06
232 0.08
233 0.07
234 0.08
235 0.08
236 0.09
237 0.08
238 0.09
239 0.09
240 0.09
241 0.09
242 0.09
243 0.09
244 0.08
245 0.09
246 0.09
247 0.09
248 0.12
249 0.11
250 0.11
251 0.15
252 0.17
253 0.21
254 0.21
255 0.23
256 0.19
257 0.2
258 0.19
259 0.15
260 0.12
261 0.09
262 0.07
263 0.06
264 0.06
265 0.05
266 0.05
267 0.06
268 0.06
269 0.06
270 0.06
271 0.1
272 0.14
273 0.15
274 0.15
275 0.15
276 0.15
277 0.18
278 0.2
279 0.23
280 0.28
281 0.34
282 0.42
283 0.48
284 0.52
285 0.53
286 0.59
287 0.58
288 0.54
289 0.51
290 0.52
291 0.54
292 0.52
293 0.51
294 0.43
295 0.41
296 0.37
297 0.38
298 0.34
299 0.29
300 0.29
301 0.29
302 0.33
303 0.31
304 0.3
305 0.28
306 0.27
307 0.25
308 0.26
309 0.27
310 0.28
311 0.29
312 0.28
313 0.27
314 0.24
315 0.23
316 0.19
317 0.16
318 0.11
319 0.08
320 0.09
321 0.09
322 0.1
323 0.1
324 0.09
325 0.1
326 0.1
327 0.1
328 0.09
329 0.09
330 0.07
331 0.08
332 0.1
333 0.1
334 0.11
335 0.11
336 0.11
337 0.1
338 0.11
339 0.12
340 0.1
341 0.11
342 0.13
343 0.14
344 0.18
345 0.22
346 0.24
347 0.3
348 0.31
349 0.3
350 0.28
351 0.31
352 0.26
353 0.23
354 0.21
355 0.14
356 0.14
357 0.14
358 0.14
359 0.12
360 0.12
361 0.11
362 0.1
363 0.1
364 0.09
365 0.08
366 0.08
367 0.07
368 0.09
369 0.09
370 0.09
371 0.11
372 0.12
373 0.11
374 0.11
375 0.11
376 0.12
377 0.13
378 0.14
379 0.13
380 0.13
381 0.14
382 0.15
383 0.19
384 0.24
385 0.26
386 0.27
387 0.32
388 0.34
389 0.41
390 0.46
391 0.5
392 0.48
393 0.48
394 0.5
395 0.53
396 0.53
397 0.47
398 0.48
399 0.47
400 0.42
401 0.42
402 0.39
403 0.33
404 0.31
405 0.33
406 0.28
407 0.22
408 0.22
409 0.2
410 0.18
411 0.16
412 0.14
413 0.09
414 0.07
415 0.06
416 0.06
417 0.03
418 0.03
419 0.03
420 0.03
421 0.03
422 0.04
423 0.04
424 0.04
425 0.07
426 0.07
427 0.08
428 0.08
429 0.09
430 0.09
431 0.09
432 0.15
433 0.13
434 0.14
435 0.15
436 0.16
437 0.16
438 0.16
439 0.16
440 0.12
441 0.12
442 0.12
443 0.11
444 0.11
445 0.11
446 0.11
447 0.11
448 0.09
449 0.1
450 0.12
451 0.14
452 0.15
453 0.22
454 0.25
455 0.31
456 0.35
457 0.36
458 0.4
459 0.46
460 0.53
461 0.49
462 0.56
463 0.51
464 0.5
465 0.5
466 0.45
467 0.37
468 0.29
469 0.24
470 0.15
471 0.17
472 0.15
473 0.16
474 0.18
475 0.24
476 0.24
477 0.25
478 0.27
479 0.26
480 0.25
481 0.22
482 0.19
483 0.12
484 0.13
485 0.12
486 0.1
487 0.08
488 0.08
489 0.11
490 0.12
491 0.15
492 0.17
493 0.18
494 0.2
495 0.22
496 0.24
497 0.2
498 0.21
499 0.25
500 0.25
501 0.24
502 0.25
503 0.24
504 0.22
505 0.24
506 0.25
507 0.2
508 0.21
509 0.21
510 0.21
511 0.22
512 0.25
513 0.27
514 0.26
515 0.26
516 0.27
517 0.28
518 0.27
519 0.29
520 0.35
521 0.33
522 0.35
523 0.36
524 0.33
525 0.34
526 0.33
527 0.32
528 0.26
529 0.24
530 0.24
531 0.25
532 0.25
533 0.24
534 0.25
535 0.27
536 0.25
537 0.24
538 0.22
539 0.22
540 0.26
541 0.29
542 0.33
543 0.31
544 0.33
545 0.34
546 0.33
547 0.32
548 0.3
549 0.28
550 0.22
551 0.2
552 0.2
553 0.19
554 0.18
555 0.15
556 0.11
557 0.09
558 0.09
559 0.08
560 0.07
561 0.08
562 0.15
563 0.2
564 0.24
565 0.25
566 0.27
567 0.31
568 0.33
569 0.32
570 0.27
571 0.24
572 0.26
573 0.25
574 0.22
575 0.18
576 0.16
577 0.15
578 0.14
579 0.1
580 0.05
581 0.05
582 0.07
583 0.07
584 0.07
585 0.08
586 0.09
587 0.09
588 0.1
589 0.09
590 0.07
591 0.07
592 0.07
593 0.07
594 0.06
595 0.06
596 0.06
597 0.06
598 0.06
599 0.07
600 0.07
601 0.11
602 0.11
603 0.12
604 0.12
605 0.14
606 0.14
607 0.13
608 0.14
609 0.11
610 0.11
611 0.12
612 0.11
613 0.09
614 0.14
615 0.15
616 0.16
617 0.14
618 0.14
619 0.14
620 0.16
621 0.18
622 0.13
623 0.12
624 0.1
625 0.1
626 0.1
627 0.09
628 0.08
629 0.07
630 0.07
631 0.08
632 0.08
633 0.07
634 0.07
635 0.07
636 0.06
637 0.06
638 0.06
639 0.05
640 0.06
641 0.06
642 0.06
643 0.06
644 0.06
645 0.07
646 0.08
647 0.09
648 0.13
649 0.13
650 0.14
651 0.16
652 0.16
653 0.15
654 0.14
655 0.15
656 0.13
657 0.14
658 0.14
659 0.13
660 0.13
661 0.13
662 0.13
663 0.13
664 0.1
665 0.09
666 0.08
667 0.08
668 0.08
669 0.07
670 0.06
671 0.05
672 0.05
673 0.04
674 0.03
675 0.03
676 0.03
677 0.02
678 0.02
679 0.02
680 0.03
681 0.03
682 0.04
683 0.04
684 0.05
685 0.07
686 0.08
687 0.1
688 0.13
689 0.14
690 0.14
691 0.14
692 0.15
693 0.14
694 0.13
695 0.12
696 0.09
697 0.11
698 0.12
699 0.11
700 0.1
701 0.1
702 0.12
703 0.13
704 0.14
705 0.17
706 0.27
707 0.34
708 0.44
709 0.52
710 0.61
711 0.71
712 0.81
713 0.86
714 0.87
715 0.91
716 0.92
717 0.95
718 0.95
719 0.95
720 0.95