Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166FXR0

Protein Details
Accession A0A166FXR0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-116LDLRAKKTRAIRRRLTKNEKSAKTLKQTKKDAHFPIHydrophilic
NLS Segment(s)
PositionSequence
81-116LDLRAKKTRAIRRRLTKNEKSAKTLKQTKKDAHFPI
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPAVKAYELQSKSKNDLSKQLVELKTELLTLRVQKIAGGSASKLTKISTVRKSIARVLTVMNQKARQNLREYYKGKKFLPLDLRAKKTRAIRRRLTKNEKSAKTLKQTKKDAHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.5
4 0.5
5 0.49
6 0.49
7 0.52
8 0.48
9 0.44
10 0.42
11 0.34
12 0.28
13 0.24
14 0.2
15 0.13
16 0.14
17 0.15
18 0.17
19 0.16
20 0.16
21 0.15
22 0.16
23 0.15
24 0.14
25 0.12
26 0.1
27 0.13
28 0.14
29 0.14
30 0.13
31 0.12
32 0.15
33 0.18
34 0.25
35 0.27
36 0.31
37 0.34
38 0.36
39 0.38
40 0.39
41 0.38
42 0.31
43 0.26
44 0.23
45 0.26
46 0.27
47 0.27
48 0.24
49 0.24
50 0.24
51 0.3
52 0.31
53 0.28
54 0.28
55 0.31
56 0.34
57 0.4
58 0.41
59 0.44
60 0.48
61 0.51
62 0.48
63 0.49
64 0.46
65 0.44
66 0.5
67 0.5
68 0.52
69 0.54
70 0.6
71 0.56
72 0.56
73 0.54
74 0.55
75 0.58
76 0.57
77 0.59
78 0.63
79 0.7
80 0.79
81 0.85
82 0.86
83 0.85
84 0.87
85 0.88
86 0.81
87 0.78
88 0.75
89 0.71
90 0.71
91 0.73
92 0.71
93 0.7
94 0.75
95 0.77
96 0.78
97 0.8
98 0.79
99 0.8
100 0.79
101 0.73
102 0.74
103 0.75