Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YBZ9

Protein Details
Accession A0A165YBZ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-88DEYPVPHKRRHKTAPEEMTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8plas 8, E.R. 4, mito_nucl 4, cyto 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022057  Chs7  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12271  Chs7  
Amino Acid Sequences MWLYVLGGVRFVLFVLSQLYYFWLNKVICEGANAKIDGSFVATMWTLGKGGCGRAAPCMAAYHRRSWDDEYPVPHKRRHKTAPEEMTTEATPKWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.08
5 0.08
6 0.1
7 0.12
8 0.12
9 0.12
10 0.16
11 0.16
12 0.16
13 0.18
14 0.17
15 0.15
16 0.17
17 0.18
18 0.15
19 0.17
20 0.17
21 0.15
22 0.14
23 0.14
24 0.12
25 0.12
26 0.08
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.08
41 0.1
42 0.1
43 0.09
44 0.09
45 0.11
46 0.11
47 0.18
48 0.2
49 0.24
50 0.27
51 0.29
52 0.31
53 0.35
54 0.39
55 0.39
56 0.4
57 0.4
58 0.43
59 0.5
60 0.51
61 0.52
62 0.55
63 0.56
64 0.62
65 0.66
66 0.7
67 0.71
68 0.78
69 0.81
70 0.77
71 0.72
72 0.64
73 0.59
74 0.49
75 0.42