Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166A6N4

Protein Details
Accession A0A166A6N4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-110LSTMNRRTLFKKKNEKRAAKFFPHydrophilic
NLS Segment(s)
PositionSequence
98-105KKKNEKRA
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MNTVNTSTGFSGFQLKMGRPPRVIPPLVPADLPKDLRGTSEALIAKTLQTDEMEAMDNLLQAKVQQAFYSNSYRGPKVVYKVRDKVILSTMNRRTLFKKKNEKRAAKFFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.3
4 0.36
5 0.4
6 0.35
7 0.37
8 0.41
9 0.45
10 0.46
11 0.38
12 0.37
13 0.38
14 0.37
15 0.34
16 0.27
17 0.23
18 0.27
19 0.27
20 0.22
21 0.18
22 0.17
23 0.18
24 0.19
25 0.17
26 0.13
27 0.17
28 0.17
29 0.16
30 0.16
31 0.15
32 0.14
33 0.12
34 0.12
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.04
49 0.06
50 0.08
51 0.08
52 0.08
53 0.1
54 0.12
55 0.16
56 0.2
57 0.19
58 0.22
59 0.24
60 0.25
61 0.23
62 0.25
63 0.25
64 0.27
65 0.35
66 0.37
67 0.42
68 0.47
69 0.49
70 0.52
71 0.49
72 0.46
73 0.44
74 0.44
75 0.4
76 0.44
77 0.47
78 0.49
79 0.5
80 0.49
81 0.49
82 0.52
83 0.58
84 0.59
85 0.65
86 0.67
87 0.77
88 0.85
89 0.9
90 0.88