Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167V6D4

Protein Details
Accession A0A167V6D4   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
375-420LRVAYIRTLEWPRRRRRRRRPREKKRNEKRPRNRRPREPGGTRPPPBasic
NLS Segment(s)
PositionSequence
177-220RERRAPAGAALRAQVLPLRRAQPRHERVERRAPEPRAQAGRHRR
386-420PRRRRRRRRPREKKRNEKRPRNRRPREPGGTRPPP
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MNIQSLLNTQDRQITPCSSMPSMSNALSPTNIPASTSHPTMSSTSPTSRSPLSAPEPIILAPHLRGHRSPLSNSPPSYTPGHSPPLKRALSPDHHDQQRSRPSHSPTMPIPARASHSPYMGLEALVQAATQEQRRMEASERAASHSPVVDRPPAASALLLLRERREPPELRQGLVPRERRAPAGAALRAQVLPLRRAQPRHERVERRAPEPRAQAGRHRREEHAADVGVEAQQTSLVVVVVVLEPQPVQLRHAHHGEQRRQRALVVRQEQHRAERVRHVEQQDEEEVAEAAAEEAEEGELEEGEGEEEEEPQPPQPGQAPADARAPQAAAAAPAEKLAPAPLAPAEPEPEAEPETRAEPAAEAKAPDIVRPLIVLRVAYIRTLEWPRRRRRRRRPREKKRNEKRPRNRRPREPGGTRPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.35
4 0.39
5 0.31
6 0.32
7 0.3
8 0.31
9 0.31
10 0.28
11 0.27
12 0.23
13 0.23
14 0.22
15 0.21
16 0.19
17 0.19
18 0.18
19 0.17
20 0.17
21 0.22
22 0.25
23 0.27
24 0.24
25 0.21
26 0.24
27 0.25
28 0.26
29 0.25
30 0.25
31 0.28
32 0.3
33 0.31
34 0.32
35 0.31
36 0.31
37 0.28
38 0.3
39 0.32
40 0.34
41 0.33
42 0.31
43 0.3
44 0.28
45 0.27
46 0.21
47 0.17
48 0.13
49 0.18
50 0.2
51 0.22
52 0.23
53 0.28
54 0.36
55 0.38
56 0.4
57 0.43
58 0.48
59 0.52
60 0.52
61 0.49
62 0.43
63 0.42
64 0.42
65 0.36
66 0.32
67 0.31
68 0.37
69 0.39
70 0.4
71 0.43
72 0.48
73 0.47
74 0.43
75 0.43
76 0.45
77 0.47
78 0.5
79 0.52
80 0.51
81 0.55
82 0.58
83 0.56
84 0.56
85 0.59
86 0.56
87 0.54
88 0.52
89 0.53
90 0.59
91 0.59
92 0.55
93 0.46
94 0.53
95 0.49
96 0.44
97 0.4
98 0.32
99 0.34
100 0.31
101 0.35
102 0.27
103 0.27
104 0.25
105 0.24
106 0.25
107 0.2
108 0.18
109 0.13
110 0.11
111 0.1
112 0.08
113 0.08
114 0.04
115 0.05
116 0.08
117 0.09
118 0.11
119 0.11
120 0.13
121 0.14
122 0.17
123 0.19
124 0.22
125 0.24
126 0.27
127 0.27
128 0.3
129 0.3
130 0.28
131 0.25
132 0.22
133 0.2
134 0.17
135 0.18
136 0.17
137 0.16
138 0.16
139 0.16
140 0.15
141 0.14
142 0.11
143 0.1
144 0.09
145 0.12
146 0.12
147 0.12
148 0.12
149 0.15
150 0.17
151 0.19
152 0.24
153 0.23
154 0.27
155 0.37
156 0.37
157 0.35
158 0.37
159 0.37
160 0.38
161 0.43
162 0.42
163 0.34
164 0.38
165 0.38
166 0.36
167 0.34
168 0.29
169 0.26
170 0.27
171 0.25
172 0.21
173 0.2
174 0.2
175 0.18
176 0.17
177 0.14
178 0.1
179 0.11
180 0.13
181 0.18
182 0.2
183 0.23
184 0.29
185 0.38
186 0.43
187 0.51
188 0.56
189 0.57
190 0.6
191 0.68
192 0.65
193 0.59
194 0.6
195 0.55
196 0.52
197 0.49
198 0.48
199 0.43
200 0.41
201 0.45
202 0.48
203 0.53
204 0.55
205 0.54
206 0.51
207 0.5
208 0.5
209 0.43
210 0.36
211 0.28
212 0.21
213 0.18
214 0.16
215 0.12
216 0.1
217 0.08
218 0.04
219 0.04
220 0.04
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.07
234 0.07
235 0.09
236 0.13
237 0.16
238 0.2
239 0.23
240 0.26
241 0.28
242 0.37
243 0.44
244 0.49
245 0.52
246 0.52
247 0.49
248 0.48
249 0.5
250 0.48
251 0.49
252 0.48
253 0.47
254 0.48
255 0.53
256 0.53
257 0.49
258 0.5
259 0.43
260 0.38
261 0.41
262 0.43
263 0.42
264 0.47
265 0.46
266 0.43
267 0.41
268 0.42
269 0.35
270 0.29
271 0.24
272 0.18
273 0.16
274 0.11
275 0.1
276 0.05
277 0.04
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.04
292 0.04
293 0.04
294 0.06
295 0.06
296 0.07
297 0.08
298 0.09
299 0.11
300 0.1
301 0.11
302 0.14
303 0.18
304 0.18
305 0.24
306 0.25
307 0.26
308 0.31
309 0.31
310 0.27
311 0.24
312 0.23
313 0.17
314 0.16
315 0.14
316 0.09
317 0.09
318 0.09
319 0.09
320 0.09
321 0.09
322 0.07
323 0.07
324 0.07
325 0.07
326 0.06
327 0.08
328 0.08
329 0.09
330 0.1
331 0.11
332 0.13
333 0.12
334 0.14
335 0.14
336 0.15
337 0.16
338 0.16
339 0.16
340 0.15
341 0.16
342 0.16
343 0.15
344 0.13
345 0.12
346 0.15
347 0.17
348 0.17
349 0.16
350 0.16
351 0.21
352 0.21
353 0.21
354 0.21
355 0.18
356 0.17
357 0.17
358 0.18
359 0.15
360 0.16
361 0.15
362 0.13
363 0.16
364 0.17
365 0.16
366 0.16
367 0.14
368 0.2
369 0.28
370 0.36
371 0.42
372 0.51
373 0.62
374 0.72
375 0.83
376 0.88
377 0.91
378 0.93
379 0.95
380 0.97
381 0.97
382 0.97
383 0.98
384 0.98
385 0.98
386 0.98
387 0.98
388 0.98
389 0.97
390 0.97
391 0.97
392 0.97
393 0.97
394 0.97
395 0.96
396 0.95
397 0.95
398 0.94
399 0.92
400 0.91