Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0W3M4

Protein Details
Accession G0W3M4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AQRVTFRRRNPYNTKSNKIKVHydrophilic
NLS Segment(s)
PositionSequence
111-122AAKKAEKKGSKK
Subcellular Location(s) mito 17, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ndi:NDAI_0A02540  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTFRRRNPYNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIALPGVAALRPRQYATVSKTHKTVSRVYGGSRCSNCVKERIVRAFLIEEQKIVKKVVKEQTEAAKKAEKKGSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.79
5 0.79
6 0.76
7 0.73
8 0.7
9 0.71
10 0.67
11 0.58
12 0.57
13 0.51
14 0.48
15 0.43
16 0.35
17 0.31
18 0.35
19 0.35
20 0.33
21 0.36
22 0.37
23 0.42
24 0.52
25 0.55
26 0.53
27 0.6
28 0.62
29 0.61
30 0.59
31 0.55
32 0.46
33 0.38
34 0.33
35 0.26
36 0.21
37 0.15
38 0.11
39 0.1
40 0.08
41 0.08
42 0.06
43 0.05
44 0.07
45 0.07
46 0.08
47 0.09
48 0.11
49 0.15
50 0.18
51 0.27
52 0.29
53 0.29
54 0.31
55 0.32
56 0.34
57 0.33
58 0.33
59 0.28
60 0.3
61 0.29
62 0.3
63 0.32
64 0.31
65 0.35
66 0.31
67 0.31
68 0.29
69 0.32
70 0.31
71 0.32
72 0.33
73 0.32
74 0.39
75 0.41
76 0.41
77 0.37
78 0.37
79 0.34
80 0.34
81 0.34
82 0.27
83 0.22
84 0.22
85 0.25
86 0.26
87 0.25
88 0.25
89 0.22
90 0.31
91 0.39
92 0.41
93 0.41
94 0.44
95 0.53
96 0.58
97 0.57
98 0.52
99 0.51
100 0.49
101 0.54
102 0.59