Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166A8M2

Protein Details
Accession A0A166A8M2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-82VPSFPPTRPRKIRSHPPQIKIRPPARHydrophilic
NLS Segment(s)
PositionSequence
64-87RPRKIRSHPPQIKIRPPARVHRRR
Subcellular Location(s) plas 8, mito 7, extr 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVVYTLSHFFGPILGPPVGGFINRNMAGARRGPVQITWVFVELLLLLAVSGLLWRAVPSFPPTRPRKIRSHPPQIKIRPPARVHRRRGVLCPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.14
5 0.13
6 0.13
7 0.12
8 0.09
9 0.16
10 0.16
11 0.17
12 0.15
13 0.16
14 0.18
15 0.19
16 0.19
17 0.15
18 0.16
19 0.16
20 0.16
21 0.18
22 0.17
23 0.17
24 0.16
25 0.14
26 0.13
27 0.12
28 0.12
29 0.08
30 0.07
31 0.05
32 0.04
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.04
43 0.04
44 0.05
45 0.1
46 0.14
47 0.17
48 0.27
49 0.32
50 0.41
51 0.49
52 0.54
53 0.6
54 0.65
55 0.74
56 0.74
57 0.81
58 0.8
59 0.8
60 0.84
61 0.82
62 0.82
63 0.81
64 0.76
65 0.74
66 0.7
67 0.74
68 0.74
69 0.76
70 0.76
71 0.75
72 0.8
73 0.75