Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166MQW9

Protein Details
Accession A0A166MQW9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30NVWTRQRWKGSRKVRAKRHRKILRDNIQGIHydrophilic
NLS Segment(s)
PositionSequence
7-46RWKGSRKVRAKRHRKILRDNIQGITKPAIRRLARRGGVKR
Subcellular Location(s) mito 12, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035425  CENP-T/H4_C  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF15511  CENP-T_C  
CDD cd00076  H4  
Amino Acid Sequences NVWTRQRWKGSRKVRAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTSLDVVYALKRSGRTLYGFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.92
4 0.91
5 0.92
6 0.91
7 0.89
8 0.89
9 0.89
10 0.89
11 0.86
12 0.8
13 0.72
14 0.66
15 0.58
16 0.49
17 0.42
18 0.35
19 0.27
20 0.28
21 0.32
22 0.3
23 0.34
24 0.39
25 0.44
26 0.45
27 0.52
28 0.53
29 0.53
30 0.56
31 0.52
32 0.46
33 0.39
34 0.34
35 0.27
36 0.24
37 0.17
38 0.13
39 0.13
40 0.12
41 0.1
42 0.1
43 0.09
44 0.08
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.09
51 0.09
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.09
58 0.1
59 0.11
60 0.14
61 0.21
62 0.26
63 0.27
64 0.29
65 0.3
66 0.32
67 0.37
68 0.35
69 0.31
70 0.31
71 0.32
72 0.3
73 0.31
74 0.28
75 0.22
76 0.21
77 0.19
78 0.17
79 0.16
80 0.17
81 0.18
82 0.21
83 0.24