Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166JB08

Protein Details
Accession A0A166JB08   
Localization Confidence High
Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-38DANARTKAPKAEKEKKEKRAPSAHydrophilic
74-94ENPNRGKEPKARKPKAKALAEBasic
NLS Segment(s)
PositionSequence
19-35ARTKAPKAEKEKKEKRA
77-90NRGKEPKARKPKAK
Subcellular Location(s) nucl 22.5, mito_nucl 13.166, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MAKASTDKSTKSATKDANARTKAPKAEKEKKEKRAPSAWNIYMGEHLKTIKEATGKTGPEAMKEVAALWKDAPENPNRGKEPKARKPKAKALAEIKVNVLDDEETASSSAAEDELLPSSSSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.58
4 0.6
5 0.59
6 0.58
7 0.56
8 0.57
9 0.58
10 0.58
11 0.58
12 0.59
13 0.66
14 0.71
15 0.76
16 0.8
17 0.82
18 0.85
19 0.82
20 0.79
21 0.78
22 0.74
23 0.71
24 0.71
25 0.62
26 0.56
27 0.5
28 0.43
29 0.39
30 0.34
31 0.26
32 0.18
33 0.17
34 0.13
35 0.13
36 0.13
37 0.1
38 0.12
39 0.11
40 0.15
41 0.2
42 0.2
43 0.19
44 0.24
45 0.22
46 0.21
47 0.23
48 0.18
49 0.13
50 0.13
51 0.13
52 0.1
53 0.1
54 0.1
55 0.07
56 0.09
57 0.09
58 0.11
59 0.13
60 0.14
61 0.2
62 0.23
63 0.29
64 0.3
65 0.32
66 0.36
67 0.42
68 0.5
69 0.54
70 0.62
71 0.65
72 0.71
73 0.77
74 0.82
75 0.83
76 0.78
77 0.75
78 0.71
79 0.7
80 0.65
81 0.57
82 0.49
83 0.41
84 0.35
85 0.27
86 0.21
87 0.14
88 0.1
89 0.12
90 0.11
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.1