Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5QYH6

Protein Details
Accession E5QYH6    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-69DGDILRLYRKWRKQRNNGKPVKKKAEEEERRRRRREKAKMKKEERKVETSBasic
NLS Segment(s)
PositionSequence
27-67YRKWRKQRNNGKPVKKKAEEEERRRRRREKAKMKKEERKVE
78-98KKESQAAKERRDRTEIKERKG
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLYAVVRRSRREEEMKKDADGDILRLYRKWRKQRNNGKPVKKKAEEEERRRRRREKAKMKKEERKVETSPLWDKGCAKKESQAAKERRDRTEIKERKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.6
4 0.56
5 0.48
6 0.43
7 0.34
8 0.27
9 0.22
10 0.21
11 0.21
12 0.21
13 0.27
14 0.31
15 0.39
16 0.48
17 0.54
18 0.63
19 0.73
20 0.83
21 0.89
22 0.91
23 0.91
24 0.92
25 0.91
26 0.89
27 0.88
28 0.8
29 0.72
30 0.69
31 0.7
32 0.69
33 0.7
34 0.72
35 0.73
36 0.77
37 0.79
38 0.78
39 0.76
40 0.77
41 0.79
42 0.79
43 0.79
44 0.83
45 0.88
46 0.92
47 0.92
48 0.9
49 0.89
50 0.83
51 0.79
52 0.71
53 0.66
54 0.59
55 0.56
56 0.5
57 0.46
58 0.42
59 0.36
60 0.38
61 0.4
62 0.44
63 0.41
64 0.38
65 0.39
66 0.45
67 0.52
68 0.56
69 0.57
70 0.57
71 0.64
72 0.72
73 0.72
74 0.69
75 0.67
76 0.64
77 0.62
78 0.66