Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0WH79

Protein Details
Accession G0WH79   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
236-257LIVWSFVRSRRRQNINNIYVNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 9, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
KEGG ndi:NDAI_0J02650  -  
Pfam View protein in Pfam  
PF06687  SUR7  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MANGIKLFLTAFLSFSALILAIIACAGSTKNYYPINSIYVAQLDLTNLNIESVLPTLSSTSTSTVFPSYITIGLWSYCTLTSNKTFISCTSPSGIQNFNLRNLLYDNIQDNQVLTIIDSISSIILPSNLQDKIKYYNSLVKCMFITLLIGIITSFLALFFALVRWFIHLTVLNLLAICFSILSFLSLLISAGTSMGTYLYIRRLLNDDDSLGVKLYLGRVYLGIIWGAVVASLLDLIVWSFVRSRRRQNINNIYVNNVETKPLIYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.08
5 0.07
6 0.06
7 0.06
8 0.04
9 0.04
10 0.04
11 0.03
12 0.04
13 0.04
14 0.05
15 0.08
16 0.1
17 0.17
18 0.2
19 0.21
20 0.24
21 0.26
22 0.28
23 0.26
24 0.26
25 0.21
26 0.19
27 0.18
28 0.15
29 0.13
30 0.11
31 0.1
32 0.1
33 0.09
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.1
48 0.11
49 0.12
50 0.13
51 0.13
52 0.13
53 0.12
54 0.12
55 0.11
56 0.1
57 0.1
58 0.09
59 0.09
60 0.09
61 0.1
62 0.08
63 0.08
64 0.08
65 0.1
66 0.1
67 0.13
68 0.15
69 0.16
70 0.17
71 0.17
72 0.17
73 0.17
74 0.22
75 0.2
76 0.19
77 0.19
78 0.21
79 0.21
80 0.23
81 0.23
82 0.19
83 0.24
84 0.24
85 0.23
86 0.23
87 0.22
88 0.2
89 0.2
90 0.19
91 0.13
92 0.14
93 0.13
94 0.13
95 0.13
96 0.12
97 0.11
98 0.1
99 0.09
100 0.07
101 0.06
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.03
111 0.04
112 0.03
113 0.04
114 0.07
115 0.08
116 0.09
117 0.09
118 0.11
119 0.16
120 0.17
121 0.18
122 0.17
123 0.23
124 0.24
125 0.29
126 0.28
127 0.24
128 0.22
129 0.21
130 0.19
131 0.11
132 0.11
133 0.05
134 0.06
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.02
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.04
149 0.04
150 0.05
151 0.06
152 0.07
153 0.07
154 0.09
155 0.09
156 0.1
157 0.11
158 0.12
159 0.1
160 0.1
161 0.09
162 0.08
163 0.06
164 0.05
165 0.04
166 0.03
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.06
186 0.09
187 0.13
188 0.13
189 0.14
190 0.17
191 0.19
192 0.22
193 0.22
194 0.2
195 0.18
196 0.19
197 0.18
198 0.15
199 0.13
200 0.1
201 0.09
202 0.1
203 0.1
204 0.09
205 0.09
206 0.09
207 0.1
208 0.1
209 0.1
210 0.08
211 0.07
212 0.06
213 0.06
214 0.05
215 0.04
216 0.04
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.04
225 0.05
226 0.05
227 0.09
228 0.14
229 0.24
230 0.31
231 0.41
232 0.5
233 0.6
234 0.67
235 0.75
236 0.82
237 0.81
238 0.84
239 0.74
240 0.68
241 0.6
242 0.53
243 0.47
244 0.36
245 0.28
246 0.21