Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166GBA3

Protein Details
Accession A0A166GBA3   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-110SLSHRPSQNPLRRKQRHNKDNRWLPLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MITKKACAVVQPASNVSKMMMIYVRTYPRTLVSFPDTLCSSIEVASTPALTAFFALAFISPEPLSHRLPSRYLELLAQCPGAQSLSHRPSQNPLRRKQRHNKDNRWLPLIENGVPRPFCGSDEERSMAWPLYLRRGNVPVDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.24
4 0.2
5 0.16
6 0.15
7 0.14
8 0.14
9 0.16
10 0.21
11 0.25
12 0.25
13 0.26
14 0.24
15 0.25
16 0.27
17 0.25
18 0.24
19 0.25
20 0.25
21 0.25
22 0.27
23 0.25
24 0.22
25 0.22
26 0.19
27 0.14
28 0.12
29 0.12
30 0.09
31 0.09
32 0.08
33 0.08
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.06
48 0.06
49 0.09
50 0.12
51 0.13
52 0.14
53 0.18
54 0.18
55 0.2
56 0.22
57 0.22
58 0.19
59 0.19
60 0.19
61 0.17
62 0.17
63 0.16
64 0.14
65 0.11
66 0.1
67 0.09
68 0.08
69 0.06
70 0.08
71 0.16
72 0.19
73 0.23
74 0.24
75 0.25
76 0.32
77 0.42
78 0.48
79 0.47
80 0.54
81 0.61
82 0.68
83 0.78
84 0.82
85 0.83
86 0.85
87 0.88
88 0.89
89 0.89
90 0.9
91 0.85
92 0.78
93 0.68
94 0.58
95 0.54
96 0.47
97 0.4
98 0.34
99 0.31
100 0.32
101 0.31
102 0.3
103 0.28
104 0.25
105 0.22
106 0.24
107 0.26
108 0.25
109 0.31
110 0.33
111 0.28
112 0.29
113 0.3
114 0.24
115 0.21
116 0.21
117 0.18
118 0.26
119 0.3
120 0.3
121 0.33
122 0.37