Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166LNP6

Protein Details
Accession A0A166LNP6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
132-155LSLHNARRDRRARKREIPPPERWYBasic
NLS Segment(s)
PositionSequence
138-147RRDRRARKRE
Subcellular Location(s) cyto 15.5, cyto_nucl 9, mito 5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MKEAHIPDDIAVLMATAMAVGAASSKAVQTTRTIFSPDGKVNVTRTEISFTFHHPCDHSPYRPPVGSTLEESTLALLRGEWPFPYSPDPSPPPTSANSHANSRANSRANSRASSPPRYQLDFEPGNFDFDKLSLHNARRDRRARKREIPPPERWYAVTRGLRVGAVLGAFMARALTHGVDGAVVVHYPSQELAEAAFDLALRAGSVEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.07
14 0.08
15 0.09
16 0.12
17 0.17
18 0.2
19 0.21
20 0.24
21 0.23
22 0.27
23 0.32
24 0.3
25 0.29
26 0.28
27 0.29
28 0.28
29 0.3
30 0.29
31 0.24
32 0.23
33 0.24
34 0.23
35 0.24
36 0.23
37 0.24
38 0.27
39 0.26
40 0.27
41 0.24
42 0.26
43 0.31
44 0.36
45 0.35
46 0.36
47 0.41
48 0.43
49 0.42
50 0.41
51 0.36
52 0.35
53 0.33
54 0.29
55 0.26
56 0.22
57 0.21
58 0.2
59 0.17
60 0.13
61 0.12
62 0.09
63 0.06
64 0.08
65 0.08
66 0.09
67 0.08
68 0.09
69 0.1
70 0.11
71 0.15
72 0.15
73 0.15
74 0.2
75 0.23
76 0.26
77 0.29
78 0.28
79 0.27
80 0.26
81 0.29
82 0.28
83 0.3
84 0.28
85 0.27
86 0.3
87 0.3
88 0.29
89 0.28
90 0.3
91 0.27
92 0.26
93 0.27
94 0.3
95 0.29
96 0.3
97 0.3
98 0.33
99 0.35
100 0.4
101 0.38
102 0.38
103 0.4
104 0.4
105 0.39
106 0.32
107 0.35
108 0.3
109 0.29
110 0.27
111 0.24
112 0.25
113 0.23
114 0.22
115 0.15
116 0.13
117 0.14
118 0.1
119 0.14
120 0.17
121 0.19
122 0.25
123 0.32
124 0.37
125 0.45
126 0.54
127 0.59
128 0.65
129 0.73
130 0.76
131 0.79
132 0.84
133 0.84
134 0.86
135 0.83
136 0.8
137 0.77
138 0.71
139 0.63
140 0.55
141 0.49
142 0.42
143 0.44
144 0.39
145 0.34
146 0.32
147 0.32
148 0.29
149 0.26
150 0.22
151 0.13
152 0.09
153 0.08
154 0.06
155 0.05
156 0.05
157 0.04
158 0.04
159 0.03
160 0.04
161 0.05
162 0.05
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.07
187 0.06
188 0.05
189 0.05