FuNGI

E4UVI7

Protein Details

Accession

E4UVI7

Localization Confidence

High

Confidence Score

15.1

NoLS Segment(s)

Position	Sequence	Protein Nature
58-86	LPVQKPEQKPTPAKPKKPAKTSKETPTSS	Hydrophilic
280-304	GLTPPLRWVRKRRFRKRISNRTIEA	Hydrophilic

NLS Segment(s)

Position	Sequence
46-143	PAPKLKLKLGLKLPVQKPEQKPTPAKPKKPAKTSKETPTSSSSKKRPRDTAADTNGKASRGAAAAEGAPVKRFKLTTKPKQPTALRIKNKGAPPVRPR
289-296	RKRRFRKR

Subcellular Location(s)

nucl 12.5, mito 11.5, cyto_nucl 8.333, cyto_mito 7.833

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0003743 F:translation initiation factor activity GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MAGRRILKLTIGKKAAQPSQPSQSAPQPSQKSPTPPRPSASSTPAPAPKLKLKLGLKLPVQKPEQKPTPAKPKKPAKTSKETPTSSSSKKRPRDTAADTNGKASRGAAAAEGAPVKRFKLTTKPKQPTALRIKNKGAPPVRPRGAGYDSEASDTEIDPALEEEFILRMEPGEDCEYLRKAIEEKRFGPRALGGADVSFKSLTRDGRRAIVTIRGNIYAAALVDLPAIIEGLKSWDKRGWYKAADICQMLLVLGKVKTEEEAHSYPLPKDVDPATFQYAHGLTPPLRWVRKRRFRKRISNRTIEAVELEVARLLKEDLAAIKPPDFEIMDQNQYARESQGEQDGFEEYDDEQDAEGEFFDESLQYEEQQYEEPLEMDDDLAAEMEAELAAHADAGSVPASATPDVSHTGDDIQEPDTESYLDVGTPQTPQTPLQAQAESSGDEDESGMSAAEDANDDLDEDALEQQHQLQEQLEEIAELEADVEAETRRWEGMNNPILKNKLGKRVQNLRQALELKKVSLGGRG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.55
2	0.57
3	0.55
4	0.56
5	0.54
6	0.58
7	0.59
8	0.57
9	0.53
10	0.54
11	0.55
12	0.52
13	0.55
14	0.53
15	0.52
16	0.56
17	0.57
18	0.59
19	0.62
20	0.68
21	0.68
22	0.66
23	0.67
24	0.67
25	0.69
26	0.65
27	0.63
28	0.59
29	0.53
30	0.56
31	0.57
32	0.54
33	0.5
34	0.5
35	0.49
36	0.49
37	0.49
38	0.5
39	0.48
40	0.53
41	0.57
42	0.58
43	0.57
44	0.61
45	0.62
46	0.61
47	0.63
48	0.64
49	0.63
50	0.65
51	0.67
52	0.65
53	0.7
54	0.71
55	0.76
56	0.78
57	0.8
58	0.8
59	0.83
60	0.84
61	0.87
62	0.88
63	0.85
64	0.85
65	0.85
66	0.85
67	0.84
68	0.77
69	0.7
70	0.67
71	0.65
72	0.62
73	0.63
74	0.63
75	0.63
76	0.69
77	0.74
78	0.75
79	0.75
80	0.77
81	0.76
82	0.77
83	0.76
84	0.75
85	0.67
86	0.64
87	0.59
88	0.5
89	0.41
90	0.31
91	0.24
92	0.17
93	0.17
94	0.12
95	0.1
96	0.1
97	0.12
98	0.13
99	0.11
100	0.12
101	0.13
102	0.13
103	0.15
104	0.15
105	0.17
106	0.26
107	0.37
108	0.46
109	0.57
110	0.63
111	0.66
112	0.74
113	0.74
114	0.74
115	0.74
116	0.73
117	0.7
118	0.7
119	0.7
120	0.67
121	0.67
122	0.66
123	0.6
124	0.58
125	0.57
126	0.6
127	0.58
128	0.53
129	0.51
130	0.47
131	0.45
132	0.38
133	0.36
134	0.3
135	0.28
136	0.27
137	0.27
138	0.22
139	0.19
140	0.17
141	0.14
142	0.1
143	0.09
144	0.08
145	0.08
146	0.08
147	0.07
148	0.06
149	0.05
150	0.05
151	0.05
152	0.05
153	0.05
154	0.04
155	0.05
156	0.06
157	0.08
158	0.1
159	0.1
160	0.11
161	0.14
162	0.15
163	0.15
164	0.15
165	0.13
166	0.14
167	0.21
168	0.28
169	0.3
170	0.33
171	0.4
172	0.43
173	0.43
174	0.4
175	0.35
176	0.29
177	0.25
178	0.22
179	0.14
180	0.12
181	0.13
182	0.12
183	0.11
184	0.09
185	0.08
186	0.09
187	0.12
188	0.17
189	0.21
190	0.25
191	0.26
192	0.3
193	0.31
194	0.3
195	0.28
196	0.3
197	0.27
198	0.25
199	0.26
200	0.21
201	0.21
202	0.19
203	0.18
204	0.11
205	0.09
206	0.07
207	0.05
208	0.05
209	0.04
210	0.04
211	0.04
212	0.03
213	0.03
214	0.03
215	0.02
216	0.02
217	0.06
218	0.09
219	0.1
220	0.11
221	0.13
222	0.16
223	0.2
224	0.24
225	0.26
226	0.24
227	0.29
228	0.31
229	0.33
230	0.33
231	0.29
232	0.25
233	0.2
234	0.19
235	0.13
236	0.1
237	0.07
238	0.06
239	0.06
240	0.06
241	0.06
242	0.06
243	0.07
244	0.08
245	0.09
246	0.12
247	0.13
248	0.16
249	0.17
250	0.18
251	0.17
252	0.2
253	0.21
254	0.15
255	0.16
256	0.15
257	0.16
258	0.16
259	0.18
260	0.17
261	0.16
262	0.16
263	0.16
264	0.15
265	0.13
266	0.12
267	0.12
268	0.09
269	0.1
270	0.14
271	0.17
272	0.2
273	0.25
274	0.34
275	0.43
276	0.54
277	0.64
278	0.71
279	0.77
280	0.84
281	0.9
282	0.92
283	0.93
284	0.91
285	0.88
286	0.79
287	0.72
288	0.63
289	0.51
290	0.4
291	0.3
292	0.21
293	0.13
294	0.11
295	0.07
296	0.07
297	0.06
298	0.06
299	0.06
300	0.05
301	0.05
302	0.06
303	0.06
304	0.08
305	0.1
306	0.1
307	0.11
308	0.11
309	0.11
310	0.12
311	0.11
312	0.1
313	0.14
314	0.17
315	0.18
316	0.18
317	0.18
318	0.18
319	0.18
320	0.18
321	0.13
322	0.11
323	0.1
324	0.11
325	0.17
326	0.16
327	0.15
328	0.16
329	0.16
330	0.15
331	0.13
332	0.13
333	0.07
334	0.08
335	0.08
336	0.08
337	0.06
338	0.07
339	0.07
340	0.06
341	0.06
342	0.05
343	0.05
344	0.04
345	0.05
346	0.04
347	0.05
348	0.07
349	0.07
350	0.08
351	0.09
352	0.09
353	0.1
354	0.1
355	0.1
356	0.09
357	0.09
358	0.09
359	0.08
360	0.09
361	0.08
362	0.07
363	0.06
364	0.05
365	0.05
366	0.05
367	0.04
368	0.04
369	0.03
370	0.03
371	0.03
372	0.03
373	0.03
374	0.03
375	0.03
376	0.03
377	0.03
378	0.03
379	0.03
380	0.04
381	0.05
382	0.04
383	0.04
384	0.05
385	0.07
386	0.07
387	0.07
388	0.07
389	0.08
390	0.11
391	0.12
392	0.12
393	0.11
394	0.12
395	0.13
396	0.13
397	0.12
398	0.11
399	0.11
400	0.13
401	0.13
402	0.12
403	0.12
404	0.11
405	0.11
406	0.1
407	0.09
408	0.08
409	0.08
410	0.08
411	0.1
412	0.1
413	0.12
414	0.13
415	0.14
416	0.18
417	0.21
418	0.24
419	0.26
420	0.27
421	0.24
422	0.25
423	0.26
424	0.22
425	0.19
426	0.16
427	0.12
428	0.1
429	0.1
430	0.08
431	0.07
432	0.07
433	0.06
434	0.05
435	0.05
436	0.05
437	0.05
438	0.06
439	0.06
440	0.06
441	0.06
442	0.07
443	0.06
444	0.06
445	0.06
446	0.06
447	0.08
448	0.08
449	0.08
450	0.08
451	0.1
452	0.12
453	0.13
454	0.13
455	0.13
456	0.13
457	0.14
458	0.15
459	0.13
460	0.1
461	0.1
462	0.09
463	0.08
464	0.07
465	0.06
466	0.05
467	0.05
468	0.05
469	0.05
470	0.06
471	0.07
472	0.08
473	0.09
474	0.1
475	0.1
476	0.12
477	0.15
478	0.25
479	0.33
480	0.38
481	0.4
482	0.44
483	0.46
484	0.47
485	0.51
486	0.48
487	0.5
488	0.52
489	0.56
490	0.61
491	0.7
492	0.76
493	0.77
494	0.76
495	0.68
496	0.68
497	0.66
498	0.59
499	0.58
500	0.51
501	0.42
502	0.39
503	0.4

E4UVI7

3D AlphaFold-predicted Structure Viewer