Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UVI7

Protein Details
Accession E4UVI7   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-86LPVQKPEQKPTPAKPKKPAKTSKETPTSSHydrophilic
280-304GLTPPLRWVRKRRFRKRISNRTIEAHydrophilic
NLS Segment(s)
PositionSequence
46-143PAPKLKLKLGLKLPVQKPEQKPTPAKPKKPAKTSKETPTSSSSKKRPRDTAADTNGKASRGAAAAEGAPVKRFKLTTKPKQPTALRIKNKGAPPVRPR
289-296RKRRFRKR
Subcellular Location(s) nucl 12.5, mito 11.5, cyto_nucl 8.333, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MAGRRILKLTIGKKAAQPSQPSQSAPQPSQKSPTPPRPSASSTPAPAPKLKLKLGLKLPVQKPEQKPTPAKPKKPAKTSKETPTSSSSKKRPRDTAADTNGKASRGAAAAEGAPVKRFKLTTKPKQPTALRIKNKGAPPVRPRGAGYDSEASDTEIDPALEEEFILRMEPGEDCEYLRKAIEEKRFGPRALGGADVSFKSLTRDGRRAIVTIRGNIYAAALVDLPAIIEGLKSWDKRGWYKAADICQMLLVLGKVKTEEEAHSYPLPKDVDPATFQYAHGLTPPLRWVRKRRFRKRISNRTIEAVELEVARLLKEDLAAIKPPDFEIMDQNQYARESQGEQDGFEEYDDEQDAEGEFFDESLQYEEQQYEEPLEMDDDLAAEMEAELAAHADAGSVPASATPDVSHTGDDIQEPDTESYLDVGTPQTPQTPLQAQAESSGDEDESGMSAAEDANDDLDEDALEQQHQLQEQLEEIAELEADVEAETRRWEGMNNPILKNKLGKRVQNLRQALELKKVSLGGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.55
4 0.56
5 0.54
6 0.58
7 0.59
8 0.57
9 0.53
10 0.54
11 0.55
12 0.52
13 0.55
14 0.53
15 0.52
16 0.56
17 0.57
18 0.59
19 0.62
20 0.68
21 0.68
22 0.66
23 0.67
24 0.67
25 0.69
26 0.65
27 0.63
28 0.59
29 0.53
30 0.56
31 0.57
32 0.54
33 0.5
34 0.5
35 0.49
36 0.49
37 0.49
38 0.5
39 0.48
40 0.53
41 0.57
42 0.58
43 0.57
44 0.61
45 0.62
46 0.61
47 0.63
48 0.64
49 0.63
50 0.65
51 0.67
52 0.65
53 0.7
54 0.71
55 0.76
56 0.78
57 0.8
58 0.8
59 0.83
60 0.84
61 0.87
62 0.88
63 0.85
64 0.85
65 0.85
66 0.85
67 0.84
68 0.77
69 0.7
70 0.67
71 0.65
72 0.62
73 0.63
74 0.63
75 0.63
76 0.69
77 0.74
78 0.75
79 0.75
80 0.77
81 0.76
82 0.77
83 0.76
84 0.75
85 0.67
86 0.64
87 0.59
88 0.5
89 0.41
90 0.31
91 0.24
92 0.17
93 0.17
94 0.12
95 0.1
96 0.1
97 0.12
98 0.13
99 0.11
100 0.12
101 0.13
102 0.13
103 0.15
104 0.15
105 0.17
106 0.26
107 0.37
108 0.46
109 0.57
110 0.63
111 0.66
112 0.74
113 0.74
114 0.74
115 0.74
116 0.73
117 0.7
118 0.7
119 0.7
120 0.67
121 0.67
122 0.66
123 0.6
124 0.58
125 0.57
126 0.6
127 0.58
128 0.53
129 0.51
130 0.47
131 0.45
132 0.38
133 0.36
134 0.3
135 0.28
136 0.27
137 0.27
138 0.22
139 0.19
140 0.17
141 0.14
142 0.1
143 0.09
144 0.08
145 0.08
146 0.08
147 0.07
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.04
155 0.05
156 0.06
157 0.08
158 0.1
159 0.1
160 0.11
161 0.14
162 0.15
163 0.15
164 0.15
165 0.13
166 0.14
167 0.21
168 0.28
169 0.3
170 0.33
171 0.4
172 0.43
173 0.43
174 0.4
175 0.35
176 0.29
177 0.25
178 0.22
179 0.14
180 0.12
181 0.13
182 0.12
183 0.11
184 0.09
185 0.08
186 0.09
187 0.12
188 0.17
189 0.21
190 0.25
191 0.26
192 0.3
193 0.31
194 0.3
195 0.28
196 0.3
197 0.27
198 0.25
199 0.26
200 0.21
201 0.21
202 0.19
203 0.18
204 0.11
205 0.09
206 0.07
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.03
215 0.02
216 0.02
217 0.06
218 0.09
219 0.1
220 0.11
221 0.13
222 0.16
223 0.2
224 0.24
225 0.26
226 0.24
227 0.29
228 0.31
229 0.33
230 0.33
231 0.29
232 0.25
233 0.2
234 0.19
235 0.13
236 0.1
237 0.07
238 0.06
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.08
245 0.09
246 0.12
247 0.13
248 0.16
249 0.17
250 0.18
251 0.17
252 0.2
253 0.21
254 0.15
255 0.16
256 0.15
257 0.16
258 0.16
259 0.18
260 0.17
261 0.16
262 0.16
263 0.16
264 0.15
265 0.13
266 0.12
267 0.12
268 0.09
269 0.1
270 0.14
271 0.17
272 0.2
273 0.25
274 0.34
275 0.43
276 0.54
277 0.64
278 0.71
279 0.77
280 0.84
281 0.9
282 0.92
283 0.93
284 0.91
285 0.88
286 0.79
287 0.72
288 0.63
289 0.51
290 0.4
291 0.3
292 0.21
293 0.13
294 0.11
295 0.07
296 0.07
297 0.06
298 0.06
299 0.06
300 0.05
301 0.05
302 0.06
303 0.06
304 0.08
305 0.1
306 0.1
307 0.11
308 0.11
309 0.11
310 0.12
311 0.11
312 0.1
313 0.14
314 0.17
315 0.18
316 0.18
317 0.18
318 0.18
319 0.18
320 0.18
321 0.13
322 0.11
323 0.1
324 0.11
325 0.17
326 0.16
327 0.15
328 0.16
329 0.16
330 0.15
331 0.13
332 0.13
333 0.07
334 0.08
335 0.08
336 0.08
337 0.06
338 0.07
339 0.07
340 0.06
341 0.06
342 0.05
343 0.05
344 0.04
345 0.05
346 0.04
347 0.05
348 0.07
349 0.07
350 0.08
351 0.09
352 0.09
353 0.1
354 0.1
355 0.1
356 0.09
357 0.09
358 0.09
359 0.08
360 0.09
361 0.08
362 0.07
363 0.06
364 0.05
365 0.05
366 0.05
367 0.04
368 0.04
369 0.03
370 0.03
371 0.03
372 0.03
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.04
381 0.05
382 0.04
383 0.04
384 0.05
385 0.07
386 0.07
387 0.07
388 0.07
389 0.08
390 0.11
391 0.12
392 0.12
393 0.11
394 0.12
395 0.13
396 0.13
397 0.12
398 0.11
399 0.11
400 0.13
401 0.13
402 0.12
403 0.12
404 0.11
405 0.11
406 0.1
407 0.09
408 0.08
409 0.08
410 0.08
411 0.1
412 0.1
413 0.12
414 0.13
415 0.14
416 0.18
417 0.21
418 0.24
419 0.26
420 0.27
421 0.24
422 0.25
423 0.26
424 0.22
425 0.19
426 0.16
427 0.12
428 0.1
429 0.1
430 0.08
431 0.07
432 0.07
433 0.06
434 0.05
435 0.05
436 0.05
437 0.05
438 0.06
439 0.06
440 0.06
441 0.06
442 0.07
443 0.06
444 0.06
445 0.06
446 0.06
447 0.08
448 0.08
449 0.08
450 0.08
451 0.1
452 0.12
453 0.13
454 0.13
455 0.13
456 0.13
457 0.14
458 0.15
459 0.13
460 0.1
461 0.1
462 0.09
463 0.08
464 0.07
465 0.06
466 0.05
467 0.05
468 0.05
469 0.05
470 0.06
471 0.07
472 0.08
473 0.09
474 0.1
475 0.1
476 0.12
477 0.15
478 0.25
479 0.33
480 0.38
481 0.4
482 0.44
483 0.46
484 0.47
485 0.51
486 0.48
487 0.5
488 0.52
489 0.56
490 0.61
491 0.7
492 0.76
493 0.77
494 0.76
495 0.68
496 0.68
497 0.66
498 0.59
499 0.58
500 0.51
501 0.42
502 0.39
503 0.4