Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5R2R9

Protein Details
Accession E5R2R9    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-41EKQDDEERRKKNKTKTTRDAESBasic
73-99KREVGGRREDEKKRRRRRGREVVDLIEBasic
NLS Segment(s)
PositionSequence
76-92VGGRREDEKKRRRRRGR
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
Amino Acid Sequences MLPAGDDSEQVDPCEVARVEKQDDEERRKKNKTKTTRDAESEKEDPLFVALWPGSLLGEMGGLKSGWGEVDEKREVGGRREDEKKRRRRRGREVVDLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.18
5 0.22
6 0.24
7 0.26
8 0.3
9 0.32
10 0.4
11 0.47
12 0.52
13 0.56
14 0.62
15 0.69
16 0.72
17 0.74
18 0.77
19 0.78
20 0.81
21 0.82
22 0.82
23 0.79
24 0.76
25 0.7
26 0.64
27 0.59
28 0.5
29 0.41
30 0.32
31 0.26
32 0.21
33 0.17
34 0.13
35 0.07
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.03
45 0.04
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.03
54 0.04
55 0.06
56 0.07
57 0.13
58 0.14
59 0.14
60 0.15
61 0.2
62 0.2
63 0.23
64 0.3
65 0.29
66 0.34
67 0.43
68 0.52
69 0.58
70 0.67
71 0.74
72 0.77
73 0.84
74 0.89
75 0.91
76 0.93
77 0.94
78 0.93
79 0.93