Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166A8N2

Protein Details
Accession A0A166A8N2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-127AKARLFSQRGKGKRHRQMQRTRSSVCHydrophilic
NLS Segment(s)
PositionSequence
64-117HKAPRKQKLKIARSRREKSQESGHGRGVQTPKVKFVKEAKARLFSQRGKGKRHR
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MFASSPRARKRSQACRATQIARELIEPLTAANSARDPPPTSKEGRRMQVKDALGDGLIWEHVAHKAPRKQKLKIARSRREKSQESGHGRGVQTPKVKFVKEAKARLFSQRGKGKRHRQMQRTRSSVCSCSGDQDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.76
4 0.71
5 0.65
6 0.59
7 0.52
8 0.43
9 0.38
10 0.31
11 0.25
12 0.21
13 0.16
14 0.11
15 0.09
16 0.09
17 0.09
18 0.08
19 0.09
20 0.1
21 0.11
22 0.14
23 0.16
24 0.19
25 0.23
26 0.26
27 0.3
28 0.35
29 0.43
30 0.47
31 0.51
32 0.57
33 0.54
34 0.54
35 0.56
36 0.51
37 0.42
38 0.36
39 0.29
40 0.2
41 0.17
42 0.13
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.07
50 0.09
51 0.15
52 0.21
53 0.28
54 0.37
55 0.42
56 0.44
57 0.49
58 0.58
59 0.62
60 0.65
61 0.7
62 0.7
63 0.76
64 0.77
65 0.78
66 0.76
67 0.69
68 0.64
69 0.62
70 0.62
71 0.59
72 0.58
73 0.53
74 0.49
75 0.46
76 0.47
77 0.41
78 0.37
79 0.35
80 0.33
81 0.37
82 0.36
83 0.37
84 0.36
85 0.41
86 0.46
87 0.48
88 0.56
89 0.54
90 0.56
91 0.57
92 0.59
93 0.61
94 0.55
95 0.56
96 0.57
97 0.59
98 0.62
99 0.7
100 0.74
101 0.75
102 0.81
103 0.81
104 0.83
105 0.87
106 0.88
107 0.88
108 0.85
109 0.79
110 0.76
111 0.72
112 0.64
113 0.57
114 0.52
115 0.43