Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166WK91

Protein Details
Accession A0A166WK91    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
252-283VPDFDPLTPKERKKKQKEVKERMEKEKCERELBasic
NLS Segment(s)
PositionSequence
261-273KERKKKQKEVKER
Subcellular Location(s) cyto 15, cyto_nucl 11.5, nucl 6, mito 3
Family & Domain DBs
Amino Acid Sequences VEDVLYSVHRYFFERDSSVFAGKGLTEAAPMALEGVSTAHFDQFLSVIYPSEYGLFTASTVEEWTAILSLADRWGFTSIRALAIKQLGPIASEIDYIVLGRQYGVEKWLSDAYEAVCRRNMPLTLEEGRRLGVDDVIRINNIRQVFGFGESSVLNISLVNRGVRTAFGLTAVGTAVGDDEADGSDWSKPDWYRSQFPQRMKENAKAAPVAAGWWGGPAPSAADPWCPPMDPPSAGGSCYGVAEPPPPPPAAVPDFDPLTPKERKKKQKEVKERMEKEKCERELVEQETLDLDVRRVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.33
4 0.35
5 0.33
6 0.29
7 0.26
8 0.21
9 0.18
10 0.18
11 0.13
12 0.09
13 0.08
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.09
38 0.1
39 0.1
40 0.08
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.07
47 0.08
48 0.07
49 0.07
50 0.06
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.07
58 0.08
59 0.07
60 0.08
61 0.1
62 0.11
63 0.11
64 0.15
65 0.14
66 0.18
67 0.18
68 0.17
69 0.18
70 0.21
71 0.21
72 0.16
73 0.17
74 0.13
75 0.13
76 0.13
77 0.11
78 0.09
79 0.09
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.04
88 0.06
89 0.06
90 0.07
91 0.09
92 0.09
93 0.09
94 0.11
95 0.13
96 0.12
97 0.11
98 0.11
99 0.11
100 0.17
101 0.17
102 0.17
103 0.17
104 0.17
105 0.18
106 0.19
107 0.19
108 0.15
109 0.15
110 0.19
111 0.23
112 0.24
113 0.24
114 0.21
115 0.21
116 0.18
117 0.18
118 0.13
119 0.1
120 0.09
121 0.09
122 0.11
123 0.11
124 0.11
125 0.1
126 0.1
127 0.11
128 0.11
129 0.1
130 0.08
131 0.1
132 0.11
133 0.12
134 0.12
135 0.09
136 0.1
137 0.09
138 0.09
139 0.07
140 0.06
141 0.05
142 0.05
143 0.05
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.08
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.06
158 0.06
159 0.05
160 0.04
161 0.03
162 0.03
163 0.03
164 0.03
165 0.02
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.05
172 0.06
173 0.06
174 0.09
175 0.09
176 0.14
177 0.22
178 0.26
179 0.3
180 0.38
181 0.49
182 0.52
183 0.58
184 0.62
185 0.6
186 0.64
187 0.63
188 0.61
189 0.56
190 0.53
191 0.49
192 0.4
193 0.35
194 0.28
195 0.23
196 0.17
197 0.12
198 0.09
199 0.07
200 0.07
201 0.06
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.08
208 0.08
209 0.11
210 0.12
211 0.16
212 0.16
213 0.15
214 0.15
215 0.18
216 0.21
217 0.2
218 0.21
219 0.22
220 0.22
221 0.22
222 0.22
223 0.19
224 0.15
225 0.15
226 0.13
227 0.08
228 0.08
229 0.1
230 0.11
231 0.13
232 0.15
233 0.15
234 0.15
235 0.16
236 0.21
237 0.22
238 0.22
239 0.22
240 0.24
241 0.25
242 0.25
243 0.27
244 0.23
245 0.26
246 0.32
247 0.38
248 0.44
249 0.53
250 0.64
251 0.72
252 0.82
253 0.86
254 0.89
255 0.93
256 0.93
257 0.94
258 0.94
259 0.92
260 0.92
261 0.9
262 0.85
263 0.83
264 0.82
265 0.74
266 0.69
267 0.63
268 0.59
269 0.58
270 0.56
271 0.52
272 0.42
273 0.4
274 0.34
275 0.33
276 0.28
277 0.2