Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X489

Protein Details
Accession A0A165X489    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-29QLSTGKRVPRTCRYVKRRKSARLLPDPHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQLSTGKRVPRTCRYVKRRKSARLLPDPHSASSRPGFHDDKLRITQAERNASNLVMTLCEARVRGGLRPAHQIYNFRWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.84
4 0.87
5 0.87
6 0.88
7 0.87
8 0.85
9 0.85
10 0.84
11 0.8
12 0.74
13 0.72
14 0.65
15 0.57
16 0.5
17 0.41
18 0.33
19 0.32
20 0.29
21 0.22
22 0.26
23 0.26
24 0.25
25 0.32
26 0.3
27 0.3
28 0.3
29 0.29
30 0.24
31 0.24
32 0.27
33 0.25
34 0.31
35 0.27
36 0.27
37 0.27
38 0.27
39 0.25
40 0.22
41 0.16
42 0.09
43 0.09
44 0.08
45 0.07
46 0.09
47 0.09
48 0.09
49 0.12
50 0.13
51 0.15
52 0.21
53 0.26
54 0.27
55 0.36
56 0.38
57 0.41
58 0.43
59 0.45