Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5R0M5

Protein Details
Accession E5R0M5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-75AVEPQEKKKTPKGRAKKRLQYTRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
53-64KKKTPKGRAKKR
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKFSAVSAAAYRTGTKEDSKKDDYRIWRYEGTNVNAVEPQEKKKTPKGRAKKRLQYTRRFVNVTMTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.13
4 0.11
5 0.11
6 0.12
7 0.12
8 0.13
9 0.13
10 0.12
11 0.13
12 0.15
13 0.18
14 0.23
15 0.27
16 0.33
17 0.39
18 0.41
19 0.43
20 0.47
21 0.5
22 0.52
23 0.5
24 0.47
25 0.45
26 0.42
27 0.44
28 0.43
29 0.38
30 0.34
31 0.31
32 0.27
33 0.25
34 0.24
35 0.21
36 0.18
37 0.19
38 0.21
39 0.24
40 0.27
41 0.35
42 0.44
43 0.51
44 0.6
45 0.67
46 0.72
47 0.81
48 0.87
49 0.89
50 0.9
51 0.91
52 0.89
53 0.89
54 0.86
55 0.85
56 0.81
57 0.73
58 0.63
59 0.6
60 0.54
61 0.48
62 0.46
63 0.39
64 0.38
65 0.38
66 0.4
67 0.38
68 0.43
69 0.48
70 0.52