Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166HPG1

Protein Details
Accession A0A166HPG1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-122QKKISIPKPIVKRGRREPRRTPAMLCHydrophilic
NLS Segment(s)
PositionSequence
91-116KRIPALQKKISIPKPIVKRGRREPRR
Subcellular Location(s) nucl 16, mito 7, golg 2
Family & Domain DBs
Amino Acid Sequences MLIWRPDSTDTLPATTLSPRLLPLSTTSQQLRILASHPFIIMTNQAWISIQMLWKDEEDIEDGCSCRNCRVWDAWQYDRPIKFTISERIAKRIPALQKKISIPKPIVKRGRREPRRTPAMLCTINPPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.15
5 0.15
6 0.14
7 0.16
8 0.15
9 0.15
10 0.17
11 0.23
12 0.23
13 0.27
14 0.27
15 0.27
16 0.29
17 0.29
18 0.26
19 0.19
20 0.19
21 0.16
22 0.16
23 0.14
24 0.13
25 0.12
26 0.11
27 0.11
28 0.11
29 0.09
30 0.1
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.12
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.1
52 0.09
53 0.09
54 0.12
55 0.13
56 0.14
57 0.18
58 0.22
59 0.29
60 0.35
61 0.38
62 0.39
63 0.41
64 0.44
65 0.41
66 0.39
67 0.33
68 0.28
69 0.26
70 0.25
71 0.29
72 0.28
73 0.34
74 0.33
75 0.37
76 0.38
77 0.36
78 0.34
79 0.33
80 0.37
81 0.4
82 0.45
83 0.44
84 0.49
85 0.54
86 0.61
87 0.61
88 0.59
89 0.54
90 0.55
91 0.6
92 0.64
93 0.68
94 0.65
95 0.69
96 0.73
97 0.8
98 0.83
99 0.84
100 0.84
101 0.85
102 0.87
103 0.81
104 0.74
105 0.71
106 0.7
107 0.64
108 0.55