Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167TYS0

Protein Details
Accession A0A167TYS0   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-101CTPPSRRSTTRRRPSPRAPSRAHydrophilic
108-143RSKASPRPRAPSPRRRPSRARRPPSRSHRWARAALRBasic
NLS Segment(s)
PositionSequence
85-168RRSTTRRRPSPRAPSRAWATTAARSKASPRPRAPSPRRRPSRARRPPSRSHRWARAALRSPASRSPPRARPSPARPSPARSKRS
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MMRSMSTAGRSPCPSLPTCPSPQRTPSRSPTHSQPAPHRSPAGRSASLSSMRTMTQHPYPQLRRSRSPLRAGTSSPSSRCTPPSRRSTTRRRPSPRAPSRAWATTAARSKASPRPRAPSPRRRPSRARRPPSRSHRWARAALRSPASRSPPRARPSPARPSPARSKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.41
4 0.41
5 0.47
6 0.51
7 0.53
8 0.55
9 0.61
10 0.65
11 0.64
12 0.65
13 0.66
14 0.68
15 0.66
16 0.66
17 0.65
18 0.65
19 0.63
20 0.62
21 0.62
22 0.61
23 0.62
24 0.61
25 0.57
26 0.48
27 0.49
28 0.5
29 0.47
30 0.39
31 0.35
32 0.34
33 0.34
34 0.36
35 0.32
36 0.26
37 0.2
38 0.19
39 0.19
40 0.19
41 0.18
42 0.2
43 0.23
44 0.26
45 0.33
46 0.37
47 0.44
48 0.51
49 0.53
50 0.52
51 0.55
52 0.61
53 0.59
54 0.62
55 0.59
56 0.55
57 0.52
58 0.48
59 0.44
60 0.4
61 0.37
62 0.3
63 0.29
64 0.26
65 0.25
66 0.29
67 0.32
68 0.35
69 0.39
70 0.48
71 0.52
72 0.57
73 0.64
74 0.7
75 0.74
76 0.76
77 0.79
78 0.78
79 0.79
80 0.81
81 0.85
82 0.83
83 0.8
84 0.72
85 0.68
86 0.64
87 0.58
88 0.51
89 0.43
90 0.36
91 0.36
92 0.39
93 0.34
94 0.3
95 0.28
96 0.31
97 0.35
98 0.41
99 0.43
100 0.42
101 0.47
102 0.54
103 0.65
104 0.71
105 0.74
106 0.76
107 0.78
108 0.82
109 0.83
110 0.86
111 0.86
112 0.87
113 0.87
114 0.87
115 0.87
116 0.87
117 0.9
118 0.89
119 0.89
120 0.87
121 0.85
122 0.84
123 0.8
124 0.81
125 0.76
126 0.76
127 0.73
128 0.69
129 0.67
130 0.6
131 0.58
132 0.56
133 0.57
134 0.54
135 0.55
136 0.58
137 0.6
138 0.63
139 0.66
140 0.67
141 0.69
142 0.71
143 0.74
144 0.73
145 0.73
146 0.72
147 0.72
148 0.76