Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167UB27

Protein Details
Accession A0A167UB27   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-76DRIYRRGIKRNARPVERLKKBasic
NLS Segment(s)
PositionSequence
61-76RRGIKRNARPVERLKK
Subcellular Location(s) nucl 14, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015661  Bub1/Mad3  
IPR013212  Mad3/Bub1_I  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
Pfam View protein in Pfam  
PF08311  Mad3_BUB1_I  
PROSITE View protein in PROSITE  
PS51489  BUB1_N  
Amino Acid Sequences YKSDLRYLKLWCQYARMVDPLAVFHDLMQNDIGERFALLYEDYAKALDAAGRQQDADRIYRRGIKRNARPVERLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.35
4 0.28
5 0.24
6 0.24
7 0.21
8 0.2
9 0.16
10 0.13
11 0.11
12 0.14
13 0.13
14 0.13
15 0.12
16 0.1
17 0.09
18 0.1
19 0.09
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.06
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.14
42 0.14
43 0.2
44 0.21
45 0.22
46 0.26
47 0.34
48 0.37
49 0.44
50 0.52
51 0.56
52 0.63
53 0.71
54 0.77
55 0.75
56 0.79