Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166J7F5

Protein Details
Accession A0A166J7F5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-80GEPPCRCYGRRRHCRHSKTPPPASWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 8.333, extr 8, cyto 4, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MLVRDLVSGCAGAGAGRGDGASKTGGTCWVVWTVLRRPLIAQHVPCTPRQRTPLRGEPPCRCYGRRRHCRHSKTPPPASWRVRRRGGVREAGWDGGGCAHGGGSAGVDWAQAMGWTVAWDPLWEGIRLQGRRHLSSVHRVGVSARVTSIKSVQQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.08
8 0.08
9 0.07
10 0.08
11 0.08
12 0.11
13 0.12
14 0.12
15 0.12
16 0.13
17 0.13
18 0.13
19 0.18
20 0.2
21 0.25
22 0.26
23 0.24
24 0.24
25 0.28
26 0.34
27 0.35
28 0.32
29 0.29
30 0.34
31 0.36
32 0.39
33 0.41
34 0.37
35 0.37
36 0.43
37 0.46
38 0.47
39 0.53
40 0.59
41 0.6
42 0.65
43 0.66
44 0.65
45 0.64
46 0.63
47 0.59
48 0.51
49 0.51
50 0.54
51 0.59
52 0.63
53 0.66
54 0.7
55 0.77
56 0.83
57 0.85
58 0.86
59 0.85
60 0.84
61 0.83
62 0.77
63 0.73
64 0.73
65 0.7
66 0.68
67 0.66
68 0.63
69 0.61
70 0.61
71 0.58
72 0.57
73 0.56
74 0.53
75 0.46
76 0.43
77 0.39
78 0.35
79 0.31
80 0.23
81 0.17
82 0.11
83 0.1
84 0.06
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.1
109 0.11
110 0.11
111 0.11
112 0.15
113 0.23
114 0.25
115 0.26
116 0.3
117 0.34
118 0.36
119 0.38
120 0.38
121 0.35
122 0.43
123 0.47
124 0.45
125 0.4
126 0.38
127 0.37
128 0.38
129 0.36
130 0.27
131 0.22
132 0.2
133 0.21
134 0.23
135 0.26