Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166RYU7

Protein Details
Accession A0A166RYU7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
109-133ASYSRCKSGRPKTSQKGKLNKQENYHydrophilic
293-328AVPPQSDRSHKRRRHHHSGRPKRKQWLQTRNHDPMFBasic
NLS Segment(s)
PositionSequence
300-316RSHKRRRHHHSGRPKRK
Subcellular Location(s) plas 18, E.R. 4, golg 2, mito 1, extr 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVDCNSTNNYLVLNTDISGLGVRISFYLQTFLLVLLVNRSVSREEAISALWTFIATSFGLTISAVVLAATEQLTLFQALHVLNLVCQIAEDPNPKQERLSNFGTFLALASYSRCKSGRPKTSQKGKLNKQENYVKLGAIIQTLLSMVLSECLWYGMLIFPPTAANLSPRTYANQLSGHCTPDVHYVLFVFKMSAKGKGRIVALVLTSLLFVGYIVVTAHELLAYYRTFKLIKLPKRSSVDSKNVPPINITPIVVMYVQPGCAQSDLPLSAPLPSTSHNFLAVPAAFAAPGHLAVPPQSDRSHKRRRHHHSGRPKRKQWLQTRNHDPMFLGIAAAQIIIFAYFVVSTEMLLLWNPYQSNGPTWGFGQVCRSNDGPKYFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.11
5 0.11
6 0.1
7 0.09
8 0.08
9 0.08
10 0.07
11 0.09
12 0.1
13 0.1
14 0.13
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.1
21 0.1
22 0.1
23 0.11
24 0.11
25 0.11
26 0.13
27 0.13
28 0.14
29 0.15
30 0.13
31 0.13
32 0.13
33 0.14
34 0.14
35 0.13
36 0.12
37 0.1
38 0.09
39 0.09
40 0.08
41 0.09
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.06
61 0.07
62 0.07
63 0.06
64 0.08
65 0.08
66 0.08
67 0.1
68 0.09
69 0.08
70 0.1
71 0.1
72 0.07
73 0.07
74 0.08
75 0.08
76 0.12
77 0.16
78 0.16
79 0.23
80 0.26
81 0.27
82 0.27
83 0.31
84 0.32
85 0.34
86 0.39
87 0.32
88 0.31
89 0.31
90 0.3
91 0.25
92 0.2
93 0.14
94 0.09
95 0.07
96 0.08
97 0.12
98 0.12
99 0.16
100 0.16
101 0.18
102 0.28
103 0.38
104 0.46
105 0.51
106 0.61
107 0.68
108 0.78
109 0.86
110 0.85
111 0.86
112 0.84
113 0.85
114 0.84
115 0.77
116 0.74
117 0.72
118 0.65
119 0.6
120 0.52
121 0.42
122 0.33
123 0.31
124 0.23
125 0.15
126 0.13
127 0.07
128 0.06
129 0.06
130 0.05
131 0.04
132 0.04
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.06
151 0.07
152 0.09
153 0.11
154 0.12
155 0.13
156 0.15
157 0.16
158 0.17
159 0.18
160 0.19
161 0.18
162 0.22
163 0.23
164 0.22
165 0.2
166 0.19
167 0.17
168 0.18
169 0.19
170 0.14
171 0.13
172 0.11
173 0.12
174 0.12
175 0.11
176 0.06
177 0.06
178 0.1
179 0.11
180 0.18
181 0.19
182 0.22
183 0.23
184 0.26
185 0.26
186 0.21
187 0.21
188 0.16
189 0.13
190 0.11
191 0.1
192 0.06
193 0.06
194 0.05
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.03
207 0.04
208 0.03
209 0.06
210 0.06
211 0.08
212 0.08
213 0.1
214 0.11
215 0.11
216 0.2
217 0.27
218 0.35
219 0.43
220 0.47
221 0.52
222 0.57
223 0.61
224 0.59
225 0.58
226 0.59
227 0.54
228 0.55
229 0.56
230 0.52
231 0.48
232 0.42
233 0.36
234 0.33
235 0.28
236 0.24
237 0.15
238 0.14
239 0.15
240 0.13
241 0.12
242 0.09
243 0.08
244 0.08
245 0.09
246 0.09
247 0.09
248 0.09
249 0.09
250 0.08
251 0.1
252 0.11
253 0.11
254 0.11
255 0.11
256 0.12
257 0.12
258 0.12
259 0.11
260 0.12
261 0.15
262 0.17
263 0.18
264 0.18
265 0.17
266 0.17
267 0.19
268 0.18
269 0.15
270 0.12
271 0.11
272 0.1
273 0.1
274 0.1
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.07
281 0.11
282 0.12
283 0.15
284 0.17
285 0.24
286 0.31
287 0.41
288 0.51
289 0.56
290 0.64
291 0.72
292 0.79
293 0.84
294 0.87
295 0.88
296 0.89
297 0.92
298 0.94
299 0.94
300 0.92
301 0.9
302 0.88
303 0.88
304 0.87
305 0.87
306 0.85
307 0.85
308 0.87
309 0.86
310 0.78
311 0.69
312 0.58
313 0.49
314 0.43
315 0.32
316 0.23
317 0.13
318 0.12
319 0.11
320 0.11
321 0.08
322 0.04
323 0.04
324 0.04
325 0.04
326 0.03
327 0.04
328 0.04
329 0.04
330 0.06
331 0.06
332 0.06
333 0.07
334 0.08
335 0.08
336 0.08
337 0.1
338 0.08
339 0.12
340 0.12
341 0.12
342 0.16
343 0.17
344 0.2
345 0.24
346 0.25
347 0.23
348 0.24
349 0.3
350 0.27
351 0.27
352 0.32
353 0.32
354 0.32
355 0.35
356 0.36
357 0.35
358 0.41