Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166EQA3

Protein Details
Accession A0A166EQA3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRVRRHPRQHRPIRLHPALLBasic
NLS Segment(s)
Subcellular Location(s) mito 21, extr 4
Family & Domain DBs
Amino Acid Sequences MRVRRHPRQHRPIRLHPALLLPYACLPQGSHGLLRRLPQTPLAYQDHCQKGIKVCSHIAPSHTRTAEPRIGVHSAPYGPRDGDTMLDLYTGFDFEEHPIATARVYEACKSTRASISAGTRHFRRGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.76
3 0.66
4 0.61
5 0.52
6 0.44
7 0.34
8 0.24
9 0.21
10 0.19
11 0.18
12 0.12
13 0.1
14 0.11
15 0.15
16 0.15
17 0.18
18 0.21
19 0.24
20 0.26
21 0.28
22 0.29
23 0.27
24 0.26
25 0.28
26 0.27
27 0.25
28 0.29
29 0.31
30 0.29
31 0.3
32 0.37
33 0.35
34 0.34
35 0.33
36 0.29
37 0.3
38 0.34
39 0.34
40 0.28
41 0.27
42 0.27
43 0.29
44 0.28
45 0.26
46 0.24
47 0.25
48 0.27
49 0.26
50 0.24
51 0.23
52 0.27
53 0.27
54 0.23
55 0.21
56 0.18
57 0.2
58 0.19
59 0.18
60 0.15
61 0.13
62 0.14
63 0.14
64 0.12
65 0.11
66 0.11
67 0.12
68 0.1
69 0.1
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.05
79 0.05
80 0.06
81 0.07
82 0.09
83 0.09
84 0.09
85 0.1
86 0.11
87 0.11
88 0.1
89 0.1
90 0.12
91 0.14
92 0.15
93 0.17
94 0.19
95 0.21
96 0.23
97 0.27
98 0.26
99 0.26
100 0.27
101 0.3
102 0.35
103 0.39
104 0.41
105 0.43
106 0.41
107 0.45