Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YRU8

Protein Details
Accession A0A165YRU8   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-107SGDHHARTRTRRQLRLRGESYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 5.5, cyto_nucl 5, cyto 3.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037034  RNA_pol_Rpb2_2_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Amino Acid Sequences MSPPQLNPRGCAYRDRSKALGIQSNKEILLLTAGNTESHKYTFAGSLEDAAKLGVFTRHQALEYIDTRVKVNRRDIGPRRPAWGKCSGDHHARTRTRRQLRLRGESYIRSDNDTTRLCVDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.52
4 0.48
5 0.51
6 0.48
7 0.5
8 0.42
9 0.41
10 0.38
11 0.38
12 0.35
13 0.31
14 0.25
15 0.16
16 0.16
17 0.11
18 0.09
19 0.09
20 0.1
21 0.1
22 0.11
23 0.12
24 0.11
25 0.11
26 0.12
27 0.1
28 0.11
29 0.13
30 0.12
31 0.13
32 0.11
33 0.13
34 0.13
35 0.12
36 0.11
37 0.09
38 0.08
39 0.06
40 0.07
41 0.06
42 0.05
43 0.07
44 0.09
45 0.09
46 0.09
47 0.1
48 0.11
49 0.13
50 0.14
51 0.17
52 0.16
53 0.16
54 0.16
55 0.19
56 0.22
57 0.23
58 0.27
59 0.3
60 0.32
61 0.41
62 0.48
63 0.54
64 0.58
65 0.55
66 0.55
67 0.56
68 0.55
69 0.5
70 0.52
71 0.45
72 0.4
73 0.44
74 0.44
75 0.45
76 0.49
77 0.51
78 0.51
79 0.55
80 0.59
81 0.63
82 0.69
83 0.7
84 0.74
85 0.77
86 0.78
87 0.8
88 0.84
89 0.77
90 0.73
91 0.69
92 0.65
93 0.61
94 0.58
95 0.5
96 0.45
97 0.43
98 0.39
99 0.42
100 0.39
101 0.35