Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167WEP3

Protein Details
Accession A0A167WEP3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-122ATALAAAPKKQKKQKRKQKKLSTEVSVSPHydrophilic
NLS Segment(s)
PositionSequence
101-113PKKQKKQKRKQKK
Subcellular Location(s) extr 10, cyto 5.5, cyto_nucl 4.5, mito 4, nucl 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MTTTLPTDTLTVTVTVPDLTASSPPRAPHGSTFYYDGLQDGDYFITSPALCTTFIPVELSDSELITREKFYAERAAKTAAREAAAALAATALAATALAAAPKKQKKQKRKQKKLSTEVSVSPKTDEVQAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.07
6 0.07
7 0.11
8 0.13
9 0.16
10 0.18
11 0.19
12 0.24
13 0.26
14 0.27
15 0.28
16 0.32
17 0.32
18 0.31
19 0.34
20 0.3
21 0.28
22 0.26
23 0.21
24 0.15
25 0.13
26 0.11
27 0.08
28 0.07
29 0.06
30 0.07
31 0.06
32 0.07
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.08
39 0.1
40 0.09
41 0.1
42 0.1
43 0.09
44 0.1
45 0.09
46 0.11
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.07
53 0.08
54 0.07
55 0.07
56 0.08
57 0.09
58 0.17
59 0.18
60 0.19
61 0.2
62 0.24
63 0.25
64 0.25
65 0.27
66 0.19
67 0.18
68 0.16
69 0.15
70 0.12
71 0.11
72 0.09
73 0.06
74 0.05
75 0.04
76 0.04
77 0.03
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.04
85 0.04
86 0.06
87 0.15
88 0.22
89 0.31
90 0.4
91 0.51
92 0.61
93 0.73
94 0.82
95 0.86
96 0.91
97 0.93
98 0.95
99 0.96
100 0.95
101 0.92
102 0.88
103 0.82
104 0.77
105 0.74
106 0.66
107 0.56
108 0.49
109 0.41
110 0.35