Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167UEG6

Protein Details
Accession A0A167UEG6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38CYCSKICQQRHWRSDHRKLCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MPLGFKGKLRRCTGCSFVCYCSKICQQRHWRSDHRKLCRIMRNSAKARVGLSGPNLRFLAYAIAHDATHSEHVPKNPYYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.54
3 0.48
4 0.46
5 0.45
6 0.42
7 0.36
8 0.35
9 0.39
10 0.43
11 0.44
12 0.5
13 0.56
14 0.64
15 0.69
16 0.71
17 0.73
18 0.74
19 0.8
20 0.8
21 0.77
22 0.74
23 0.72
24 0.73
25 0.71
26 0.65
27 0.62
28 0.61
29 0.61
30 0.58
31 0.59
32 0.53
33 0.45
34 0.42
35 0.36
36 0.29
37 0.22
38 0.22
39 0.24
40 0.22
41 0.25
42 0.24
43 0.23
44 0.22
45 0.2
46 0.2
47 0.13
48 0.13
49 0.12
50 0.13
51 0.13
52 0.13
53 0.13
54 0.11
55 0.14
56 0.14
57 0.16
58 0.19
59 0.23
60 0.29