Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UW34

Protein Details
Accession E4UW34   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-129GPSRIRARRDEAREKKRKEKKNPLWENGPETBasic
NLS Segment(s)
PositionSequence
102-120RIRARRDEAREKKRKEKKN
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MQQANAPEDGREEGARQGVPRRFPILSSQSSGGRFDVCSRETQDEAGHPASSHTGERAADGTPDRELRRPVRMYVCTDFRKRVWCVSVGTSNVFMYQPGPSRIRARRDEAREKKRKEKKNPLWENGPETRGSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.26
5 0.29
6 0.32
7 0.34
8 0.36
9 0.33
10 0.33
11 0.39
12 0.38
13 0.36
14 0.35
15 0.34
16 0.33
17 0.34
18 0.34
19 0.27
20 0.21
21 0.18
22 0.18
23 0.2
24 0.18
25 0.19
26 0.21
27 0.24
28 0.23
29 0.24
30 0.22
31 0.19
32 0.21
33 0.19
34 0.16
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.09
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.13
51 0.14
52 0.15
53 0.19
54 0.2
55 0.26
56 0.27
57 0.29
58 0.32
59 0.33
60 0.36
61 0.36
62 0.4
63 0.38
64 0.39
65 0.39
66 0.35
67 0.38
68 0.35
69 0.35
70 0.31
71 0.28
72 0.28
73 0.29
74 0.31
75 0.26
76 0.26
77 0.23
78 0.21
79 0.19
80 0.17
81 0.13
82 0.1
83 0.11
84 0.14
85 0.17
86 0.19
87 0.21
88 0.3
89 0.36
90 0.43
91 0.46
92 0.5
93 0.55
94 0.62
95 0.7
96 0.73
97 0.77
98 0.8
99 0.82
100 0.85
101 0.86
102 0.88
103 0.88
104 0.89
105 0.88
106 0.9
107 0.93
108 0.89
109 0.88
110 0.83
111 0.79
112 0.74
113 0.65
114 0.55