Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166EP90

Protein Details
Accession A0A166EP90    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-75TWSSLRQDPKPPRTRRSRHTKFSDPSTNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MWLERELRDVMRIGMELLKPRVEGLGLQRQQGAEQVTVSSTSGSDSTWSSLRQDPKPPRTRRSRHTKFSDPSTNSVARHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.2
5 0.2
6 0.19
7 0.19
8 0.18
9 0.14
10 0.14
11 0.15
12 0.24
13 0.24
14 0.25
15 0.26
16 0.25
17 0.25
18 0.26
19 0.22
20 0.11
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.07
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.08
34 0.09
35 0.1
36 0.12
37 0.17
38 0.23
39 0.26
40 0.35
41 0.43
42 0.52
43 0.62
44 0.67
45 0.71
46 0.76
47 0.81
48 0.81
49 0.83
50 0.82
51 0.82
52 0.84
53 0.85
54 0.8
55 0.81
56 0.81
57 0.74
58 0.68
59 0.65
60 0.6