Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V5D6

Protein Details
Accession E4V5D6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-50TATGRALRRIKARRRRDARYTGSRRIRYHydrophilic
NLS Segment(s)
PositionSequence
28-42ALRRIKARRRRDARY
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MYRGLAASSRTNNAYTNIMTLETATGRALRRIKARRRRDARYTGSRRIRYPPGYSCDELQESLNSSQLKRGGQFRIKIKGLDYLKFSRSIKSPILKSDSNLTVLSSKIFRNYSDRNNALLIPVTTNDSISGQYKIDYTLAKGSLISGAVIDSEGEKLTTISSLTASSSGSTSFKLDEEDLGDMTLLGWINNTGDIQLNYTVSLPQSQPSSSPGRTSRPTASAPAASGAVRPSVIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.24
3 0.22
4 0.19
5 0.18
6 0.17
7 0.15
8 0.15
9 0.12
10 0.12
11 0.1
12 0.13
13 0.14
14 0.2
15 0.24
16 0.27
17 0.37
18 0.46
19 0.56
20 0.63
21 0.73
22 0.77
23 0.82
24 0.86
25 0.86
26 0.86
27 0.85
28 0.85
29 0.83
30 0.82
31 0.83
32 0.79
33 0.72
34 0.69
35 0.68
36 0.62
37 0.6
38 0.57
39 0.52
40 0.54
41 0.52
42 0.46
43 0.42
44 0.38
45 0.33
46 0.27
47 0.22
48 0.2
49 0.19
50 0.21
51 0.18
52 0.17
53 0.19
54 0.21
55 0.22
56 0.21
57 0.26
58 0.3
59 0.34
60 0.41
61 0.43
62 0.47
63 0.47
64 0.46
65 0.41
66 0.41
67 0.38
68 0.34
69 0.34
70 0.3
71 0.3
72 0.33
73 0.33
74 0.28
75 0.28
76 0.3
77 0.3
78 0.32
79 0.33
80 0.33
81 0.38
82 0.35
83 0.33
84 0.34
85 0.3
86 0.26
87 0.25
88 0.21
89 0.16
90 0.16
91 0.16
92 0.12
93 0.11
94 0.12
95 0.13
96 0.13
97 0.18
98 0.23
99 0.28
100 0.34
101 0.35
102 0.32
103 0.32
104 0.31
105 0.26
106 0.22
107 0.16
108 0.09
109 0.08
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.09
117 0.1
118 0.08
119 0.09
120 0.09
121 0.09
122 0.1
123 0.09
124 0.09
125 0.11
126 0.12
127 0.11
128 0.11
129 0.1
130 0.1
131 0.1
132 0.08
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.08
156 0.08
157 0.09
158 0.09
159 0.1
160 0.1
161 0.11
162 0.11
163 0.11
164 0.12
165 0.13
166 0.12
167 0.11
168 0.1
169 0.08
170 0.08
171 0.08
172 0.07
173 0.05
174 0.05
175 0.06
176 0.06
177 0.07
178 0.07
179 0.06
180 0.08
181 0.09
182 0.11
183 0.12
184 0.12
185 0.12
186 0.13
187 0.13
188 0.11
189 0.14
190 0.13
191 0.14
192 0.16
193 0.16
194 0.17
195 0.2
196 0.27
197 0.25
198 0.31
199 0.33
200 0.38
201 0.42
202 0.46
203 0.47
204 0.45
205 0.47
206 0.44
207 0.45
208 0.39
209 0.36
210 0.33
211 0.29
212 0.24
213 0.22
214 0.19
215 0.15