Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VGW1

Protein Details
Accession A0A167VGW1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-98ILQVYPLRRHRRRCVLRRRRARPERVHPSRLGBasic
NLS Segment(s)
PositionSequence
74-91RRHRRRCVLRRRRARPER
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MEISTIPLYIPSPALTDSAFPFTHAQRSKKLYNLPTLSASNPTTQSPSTTTRILTLTQPNHFTRNAILQVYPLRRHRRRCVLRRRRARPERVHPSRLGIGMHIQQRLLQQLLCRLHLRLRAPRVDLHRSAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.14
5 0.17
6 0.16
7 0.17
8 0.19
9 0.19
10 0.28
11 0.33
12 0.34
13 0.37
14 0.44
15 0.46
16 0.49
17 0.55
18 0.51
19 0.54
20 0.53
21 0.48
22 0.46
23 0.43
24 0.38
25 0.35
26 0.31
27 0.24
28 0.22
29 0.2
30 0.19
31 0.18
32 0.19
33 0.18
34 0.22
35 0.22
36 0.22
37 0.22
38 0.21
39 0.22
40 0.21
41 0.21
42 0.23
43 0.24
44 0.25
45 0.29
46 0.28
47 0.3
48 0.28
49 0.25
50 0.2
51 0.2
52 0.19
53 0.15
54 0.14
55 0.13
56 0.18
57 0.21
58 0.24
59 0.27
60 0.36
61 0.42
62 0.49
63 0.56
64 0.62
65 0.7
66 0.76
67 0.8
68 0.82
69 0.86
70 0.89
71 0.9
72 0.9
73 0.9
74 0.9
75 0.88
76 0.88
77 0.88
78 0.86
79 0.82
80 0.72
81 0.67
82 0.59
83 0.51
84 0.4
85 0.3
86 0.25
87 0.25
88 0.28
89 0.24
90 0.21
91 0.21
92 0.23
93 0.25
94 0.22
95 0.18
96 0.16
97 0.24
98 0.26
99 0.28
100 0.28
101 0.27
102 0.31
103 0.36
104 0.41
105 0.42
106 0.47
107 0.49
108 0.51
109 0.56
110 0.58
111 0.6