Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167SN72

Protein Details
Accession A0A167SN72    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPPKRRPKTHRDHSRRRTCCMVBasic
NLS Segment(s)
PositionSequence
5-14KRRPKTHRDH
Subcellular Location(s) mito 17, mito_nucl 13.666, nucl 8, cyto_nucl 5.666
Family & Domain DBs
Amino Acid Sequences MPPPKRRPKTHRDHSRRRTCCMVLRTYLRKRSTRVWTCRASWGLFANKFFMYRYFGVDDSIRSPFLRFYIRRIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.88
4 0.83
5 0.79
6 0.72
7 0.69
8 0.63
9 0.57
10 0.51
11 0.54
12 0.58
13 0.58
14 0.62
15 0.59
16 0.57
17 0.56
18 0.58
19 0.61
20 0.62
21 0.62
22 0.6
23 0.58
24 0.56
25 0.58
26 0.52
27 0.42
28 0.34
29 0.3
30 0.3
31 0.28
32 0.26
33 0.24
34 0.22
35 0.22
36 0.21
37 0.18
38 0.17
39 0.16
40 0.19
41 0.19
42 0.19
43 0.21
44 0.21
45 0.21
46 0.19
47 0.2
48 0.18
49 0.16
50 0.17
51 0.16
52 0.19
53 0.26
54 0.24
55 0.29