Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YY14

Protein Details
Accession A0A165YY14    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-32VSCIRIRRWRMSTRRTRSIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 8, extr 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MSHGMIGSITMLVSCIRIRRWRMSTRRTRSIGIVGGGDETREGGFMNAQDGIHAGIARGEIAIALPSVAALLPLLLGPTSGTDVTRNPTSTPNMNAGIPLTSLYTWILDETFLTKESEEILDVVMKASVALRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.16
4 0.24
5 0.29
6 0.38
7 0.45
8 0.54
9 0.62
10 0.7
11 0.76
12 0.78
13 0.82
14 0.77
15 0.71
16 0.64
17 0.59
18 0.51
19 0.41
20 0.32
21 0.23
22 0.2
23 0.18
24 0.15
25 0.1
26 0.07
27 0.06
28 0.06
29 0.05
30 0.04
31 0.05
32 0.05
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.05
42 0.04
43 0.05
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.03
66 0.05
67 0.05
68 0.05
69 0.06
70 0.08
71 0.12
72 0.14
73 0.15
74 0.15
75 0.18
76 0.21
77 0.24
78 0.25
79 0.25
80 0.24
81 0.23
82 0.22
83 0.19
84 0.16
85 0.13
86 0.11
87 0.09
88 0.07
89 0.08
90 0.08
91 0.08
92 0.07
93 0.08
94 0.07
95 0.06
96 0.07
97 0.08
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.12
104 0.12
105 0.11
106 0.1
107 0.1
108 0.11
109 0.11
110 0.11
111 0.09
112 0.08
113 0.08