Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UW49

Protein Details
Accession E4UW49   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-73FKLPKNSRQLREKKRGKANAARKPBasic
NLS Segment(s)
PositionSequence
54-73KNSRQLREKKRGKANAARKP
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLRQRHSITGKEVDGLTISEGYRNAFLCFWPYSFCCFLRLTGLLSETWDFKLPKNSRQLREKKRGKANAARKPGPDWIYVSTTVNFKGLAASASH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.16
4 0.12
5 0.11
6 0.11
7 0.11
8 0.12
9 0.13
10 0.13
11 0.13
12 0.11
13 0.12
14 0.14
15 0.14
16 0.14
17 0.15
18 0.15
19 0.18
20 0.21
21 0.21
22 0.2
23 0.2
24 0.2
25 0.2
26 0.2
27 0.17
28 0.14
29 0.15
30 0.12
31 0.12
32 0.12
33 0.1
34 0.1
35 0.12
36 0.11
37 0.12
38 0.22
39 0.23
40 0.28
41 0.38
42 0.45
43 0.49
44 0.58
45 0.68
46 0.68
47 0.77
48 0.8
49 0.79
50 0.81
51 0.82
52 0.81
53 0.8
54 0.81
55 0.79
56 0.8
57 0.75
58 0.66
59 0.62
60 0.61
61 0.53
62 0.45
63 0.38
64 0.33
65 0.32
66 0.32
67 0.31
68 0.26
69 0.25
70 0.23
71 0.21
72 0.17
73 0.14
74 0.14
75 0.12