Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166DYV8

Protein Details
Accession A0A166DYV8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-63QGQEPAPKKERKRRAPTKKPKEDVAVBasic
65-90GLAPASKRHRRAHPSRRSRTSPCRRTBasic
NLS Segment(s)
PositionSequence
22-83VRKRKSAKEKEADAAVQGQEPAPKKERKRRAPTKKPKEDVAVLGLAPASKRHRRAHPSRRSR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MVGSNAPEPDSARPTPAPEGSVRKRKSAKEKEADAAVQGQEPAPKKERKRRAPTKKPKEDVAVLGLAPASKRHRRAHPSRRSRTSPCRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.3
4 0.28
5 0.27
6 0.36
7 0.4
8 0.49
9 0.47
10 0.51
11 0.56
12 0.61
13 0.67
14 0.69
15 0.7
16 0.68
17 0.71
18 0.66
19 0.62
20 0.55
21 0.44
22 0.35
23 0.25
24 0.17
25 0.13
26 0.1
27 0.11
28 0.13
29 0.15
30 0.19
31 0.24
32 0.31
33 0.41
34 0.51
35 0.58
36 0.68
37 0.76
38 0.82
39 0.87
40 0.92
41 0.93
42 0.93
43 0.87
44 0.8
45 0.74
46 0.66
47 0.57
48 0.48
49 0.38
50 0.27
51 0.23
52 0.19
53 0.14
54 0.11
55 0.13
56 0.17
57 0.23
58 0.3
59 0.37
60 0.47
61 0.57
62 0.68
63 0.75
64 0.79
65 0.83
66 0.87
67 0.89
68 0.88
69 0.87
70 0.88