Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166U4I0

Protein Details
Accession A0A166U4I0    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LAVPKKKVSHSRKSMRSADKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.166, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences FLLAVPKKKVSHSRKSMRSADKGLVDKQNIVNCPACGMPKLSHHLCQECYGSLSRQWKME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.82
4 0.78
5 0.76
6 0.69
7 0.62
8 0.57
9 0.52
10 0.48
11 0.43
12 0.36
13 0.32
14 0.32
15 0.31
16 0.26
17 0.25
18 0.22
19 0.17
20 0.18
21 0.16
22 0.14
23 0.12
24 0.14
25 0.13
26 0.16
27 0.23
28 0.24
29 0.3
30 0.33
31 0.37
32 0.36
33 0.37
34 0.35
35 0.29
36 0.3
37 0.26
38 0.24
39 0.26
40 0.32