Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166ATZ0

Protein Details
Accession A0A166ATZ0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKAAKKPQGPKRTQPLDTHydrophilic
NLS Segment(s)
PositionSequence
3-14KRKAAKKPQGPK
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAAKKPQGPKRTQPLDTTFTCLYCHHENSVTVRMNKKEGIAHLACRICDQRYQSKVHHLTEPIDVYAEYVDAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.76
4 0.72
5 0.67
6 0.61
7 0.55
8 0.52
9 0.42
10 0.34
11 0.32
12 0.26
13 0.26
14 0.24
15 0.25
16 0.21
17 0.22
18 0.22
19 0.25
20 0.31
21 0.29
22 0.28
23 0.3
24 0.29
25 0.29
26 0.29
27 0.26
28 0.21
29 0.18
30 0.22
31 0.2
32 0.2
33 0.23
34 0.24
35 0.23
36 0.23
37 0.24
38 0.19
39 0.22
40 0.25
41 0.29
42 0.32
43 0.37
44 0.38
45 0.46
46 0.51
47 0.5
48 0.5
49 0.43
50 0.41
51 0.41
52 0.4
53 0.3
54 0.25
55 0.22
56 0.18
57 0.16
58 0.13