Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166TU63

Protein Details
Accession A0A166TU63    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-74RSAPRARSRTRKRTWRSWRTSKNLHCKIWHydrophilic
NLS Segment(s)
PositionSequence
46-61RSAPRARSRTRKRTWR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLELDGQTVGIHTSAIAEKCKAFETLVIYCSTLGGRFAPTSARTARSAPRARSRTRKRTWRSWRTSKNLHCKIWRSCCTTRIRSNPLLIAVSSVRDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.14
4 0.15
5 0.15
6 0.17
7 0.18
8 0.17
9 0.14
10 0.15
11 0.17
12 0.18
13 0.19
14 0.18
15 0.17
16 0.16
17 0.16
18 0.14
19 0.09
20 0.08
21 0.07
22 0.08
23 0.07
24 0.08
25 0.1
26 0.1
27 0.14
28 0.15
29 0.17
30 0.17
31 0.19
32 0.23
33 0.3
34 0.35
35 0.36
36 0.43
37 0.46
38 0.5
39 0.58
40 0.65
41 0.66
42 0.7
43 0.76
44 0.73
45 0.79
46 0.85
47 0.85
48 0.84
49 0.85
50 0.85
51 0.83
52 0.86
53 0.84
54 0.84
55 0.82
56 0.78
57 0.74
58 0.72
59 0.74
60 0.74
61 0.72
62 0.68
63 0.64
64 0.65
65 0.67
66 0.68
67 0.69
68 0.67
69 0.68
70 0.65
71 0.66
72 0.61
73 0.55
74 0.48
75 0.39
76 0.33
77 0.26