Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166S556

Protein Details
Accession A0A166S556    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-64MSPLSTPSSSRKRERERENETPSQRHKRVMAAERQRRKRERDRNNSLNQNGSHydrophilic
NLS Segment(s)
PositionSequence
23-53RKRERERENETPSQRHKRVMAAERQRRKRER
108-133KARRERVRAAARERQRKHRALVKDRK
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
Amino Acid Sequences MDPSLQINNDNGMSPLSTPSSSRKRERERENETPSQRHKRVMAAERQRRKRERDRNNSLNQNGSISSIGKTNGHPTPVFSSPNQQLPPPAPPPPDSNRDEDDLSPEEKARRERVRAAARERQRKHRALVKDRKMRELGLDMGNEITDVHYPRDGQYLMPHELDQQQHHELDQQQHEEIVQPEPPYPQGQPLGGQTFASTLLLSFSCAPLLKQHLLRNLQMTNEELASLEPVIADAWDQWDHQRRLHYAQQAAADEAAKGAGPSSASVHAYAPAEHMTMPNGSVSNAMGYPTGSEHVHDAAGFRTRFQRSLVAPSPFRTVDTQATTPNTPSSTMSATASNASNASGPPSDNLSDLGQARGEAEGVVGRLEGLGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.17
6 0.25
7 0.34
8 0.42
9 0.5
10 0.58
11 0.66
12 0.75
13 0.84
14 0.85
15 0.85
16 0.87
17 0.86
18 0.86
19 0.82
20 0.81
21 0.8
22 0.8
23 0.74
24 0.7
25 0.64
26 0.61
27 0.64
28 0.64
29 0.65
30 0.65
31 0.72
32 0.77
33 0.84
34 0.87
35 0.86
36 0.86
37 0.87
38 0.87
39 0.87
40 0.88
41 0.89
42 0.88
43 0.9
44 0.9
45 0.82
46 0.76
47 0.66
48 0.57
49 0.46
50 0.38
51 0.3
52 0.21
53 0.19
54 0.15
55 0.16
56 0.15
57 0.16
58 0.2
59 0.22
60 0.24
61 0.23
62 0.24
63 0.28
64 0.3
65 0.32
66 0.27
67 0.32
68 0.32
69 0.39
70 0.37
71 0.32
72 0.32
73 0.32
74 0.37
75 0.34
76 0.35
77 0.31
78 0.32
79 0.38
80 0.4
81 0.45
82 0.41
83 0.42
84 0.4
85 0.4
86 0.4
87 0.34
88 0.33
89 0.28
90 0.26
91 0.22
92 0.21
93 0.21
94 0.23
95 0.27
96 0.31
97 0.35
98 0.39
99 0.44
100 0.52
101 0.59
102 0.62
103 0.65
104 0.65
105 0.68
106 0.74
107 0.72
108 0.74
109 0.73
110 0.71
111 0.69
112 0.68
113 0.68
114 0.69
115 0.75
116 0.75
117 0.75
118 0.72
119 0.72
120 0.66
121 0.56
122 0.47
123 0.4
124 0.33
125 0.26
126 0.24
127 0.19
128 0.17
129 0.16
130 0.14
131 0.1
132 0.07
133 0.06
134 0.07
135 0.08
136 0.09
137 0.1
138 0.1
139 0.14
140 0.13
141 0.12
142 0.15
143 0.19
144 0.2
145 0.2
146 0.2
147 0.18
148 0.21
149 0.23
150 0.2
151 0.19
152 0.19
153 0.18
154 0.18
155 0.2
156 0.19
157 0.23
158 0.24
159 0.21
160 0.19
161 0.19
162 0.19
163 0.18
164 0.16
165 0.12
166 0.11
167 0.1
168 0.11
169 0.11
170 0.12
171 0.12
172 0.11
173 0.13
174 0.12
175 0.12
176 0.12
177 0.14
178 0.15
179 0.13
180 0.13
181 0.1
182 0.09
183 0.09
184 0.08
185 0.06
186 0.04
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.08
196 0.13
197 0.15
198 0.19
199 0.22
200 0.28
201 0.31
202 0.32
203 0.33
204 0.3
205 0.27
206 0.24
207 0.22
208 0.16
209 0.13
210 0.12
211 0.09
212 0.08
213 0.07
214 0.07
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.03
222 0.05
223 0.06
224 0.07
225 0.11
226 0.21
227 0.22
228 0.25
229 0.29
230 0.3
231 0.35
232 0.41
233 0.42
234 0.35
235 0.37
236 0.38
237 0.34
238 0.32
239 0.26
240 0.2
241 0.14
242 0.12
243 0.09
244 0.06
245 0.05
246 0.04
247 0.04
248 0.04
249 0.05
250 0.07
251 0.09
252 0.1
253 0.11
254 0.11
255 0.13
256 0.14
257 0.13
258 0.13
259 0.11
260 0.11
261 0.11
262 0.11
263 0.1
264 0.09
265 0.1
266 0.09
267 0.09
268 0.08
269 0.09
270 0.09
271 0.09
272 0.09
273 0.09
274 0.08
275 0.08
276 0.08
277 0.08
278 0.1
279 0.09
280 0.09
281 0.11
282 0.11
283 0.12
284 0.11
285 0.11
286 0.11
287 0.18
288 0.17
289 0.18
290 0.24
291 0.26
292 0.28
293 0.29
294 0.34
295 0.29
296 0.39
297 0.44
298 0.43
299 0.43
300 0.43
301 0.46
302 0.4
303 0.39
304 0.33
305 0.3
306 0.3
307 0.33
308 0.33
309 0.32
310 0.36
311 0.35
312 0.34
313 0.33
314 0.28
315 0.24
316 0.23
317 0.22
318 0.21
319 0.21
320 0.21
321 0.2
322 0.2
323 0.21
324 0.2
325 0.18
326 0.15
327 0.14
328 0.14
329 0.13
330 0.16
331 0.14
332 0.14
333 0.15
334 0.18
335 0.19
336 0.18
337 0.2
338 0.18
339 0.21
340 0.21
341 0.21
342 0.17
343 0.16
344 0.16
345 0.15
346 0.13
347 0.09
348 0.08
349 0.09
350 0.08
351 0.09
352 0.08
353 0.07
354 0.07