Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0W3U6

Protein Details
Accession G0W3U6    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
350-370EPAQVFMKKLNKRTNNSRLPIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002376  Formyl_transf_N  
IPR036477  Formyl_transf_N_sf  
Gene Ontology GO:0009058  P:biosynthetic process  
KEGG ndi:NDAI_0A03270  -  
Pfam View protein in Pfam  
PF00551  Formyl_trans_N  
Amino Acid Sequences MLNIYKRLLIRWNSTLSRPISSPPLNVLFFGTDEFSNFTLKTLFSLKNKEPKLINSIQVVTKPSIWCGRRHSKLFIPPVTGLYNSLNDSTLPPIIPYDSNDVQPIKDLINKESINMIIATSFGYLIPAELIKMVPYSMNVHPSLLPQYKGSSPLQYTLLNRNLVTGITIQELDPFKFDAGKIIEQTPEISIESLNLNRPISSKPVEGGWKTLLLRDKLGEISQNLLKNVLIKKLYLPENIARNSTVNKKYERSMAPRLKKEMNRVIWGDDSIDDIVNKFDVLGPLFTFYQGKRVLLHDITIKKLEVNLSTTAQGQFWLDTKDQSVFVNVNDQDQKLLKIGLLQLEGYPVEPAQVFMKKLNKRTNNSRLPINPSNLVFTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.48
4 0.46
5 0.4
6 0.38
7 0.39
8 0.38
9 0.37
10 0.35
11 0.39
12 0.35
13 0.35
14 0.33
15 0.25
16 0.23
17 0.22
18 0.18
19 0.12
20 0.13
21 0.15
22 0.14
23 0.15
24 0.15
25 0.14
26 0.14
27 0.14
28 0.15
29 0.19
30 0.23
31 0.27
32 0.35
33 0.41
34 0.49
35 0.51
36 0.54
37 0.52
38 0.5
39 0.53
40 0.5
41 0.48
42 0.43
43 0.44
44 0.41
45 0.4
46 0.39
47 0.32
48 0.31
49 0.28
50 0.27
51 0.33
52 0.32
53 0.35
54 0.41
55 0.49
56 0.53
57 0.57
58 0.59
59 0.58
60 0.65
61 0.68
62 0.62
63 0.57
64 0.49
65 0.48
66 0.44
67 0.36
68 0.3
69 0.23
70 0.22
71 0.18
72 0.18
73 0.15
74 0.14
75 0.15
76 0.15
77 0.14
78 0.12
79 0.11
80 0.11
81 0.13
82 0.13
83 0.14
84 0.19
85 0.19
86 0.2
87 0.23
88 0.23
89 0.21
90 0.22
91 0.21
92 0.15
93 0.17
94 0.18
95 0.17
96 0.24
97 0.24
98 0.23
99 0.23
100 0.22
101 0.19
102 0.17
103 0.15
104 0.07
105 0.07
106 0.07
107 0.06
108 0.06
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.11
124 0.12
125 0.15
126 0.15
127 0.16
128 0.16
129 0.17
130 0.23
131 0.21
132 0.2
133 0.17
134 0.19
135 0.19
136 0.23
137 0.23
138 0.2
139 0.19
140 0.2
141 0.22
142 0.22
143 0.23
144 0.26
145 0.29
146 0.27
147 0.26
148 0.24
149 0.22
150 0.2
151 0.18
152 0.12
153 0.08
154 0.08
155 0.08
156 0.07
157 0.11
158 0.12
159 0.11
160 0.11
161 0.11
162 0.1
163 0.11
164 0.11
165 0.11
166 0.12
167 0.13
168 0.14
169 0.15
170 0.15
171 0.14
172 0.15
173 0.11
174 0.1
175 0.08
176 0.07
177 0.06
178 0.06
179 0.08
180 0.08
181 0.09
182 0.1
183 0.1
184 0.1
185 0.12
186 0.12
187 0.15
188 0.16
189 0.15
190 0.14
191 0.17
192 0.2
193 0.19
194 0.2
195 0.17
196 0.18
197 0.17
198 0.2
199 0.21
200 0.19
201 0.19
202 0.17
203 0.18
204 0.16
205 0.16
206 0.15
207 0.11
208 0.13
209 0.16
210 0.17
211 0.16
212 0.15
213 0.15
214 0.18
215 0.19
216 0.2
217 0.17
218 0.16
219 0.18
220 0.24
221 0.27
222 0.23
223 0.25
224 0.25
225 0.31
226 0.32
227 0.31
228 0.26
229 0.24
230 0.26
231 0.31
232 0.32
233 0.3
234 0.32
235 0.34
236 0.35
237 0.42
238 0.44
239 0.43
240 0.48
241 0.54
242 0.58
243 0.62
244 0.65
245 0.65
246 0.63
247 0.65
248 0.64
249 0.59
250 0.56
251 0.51
252 0.49
253 0.41
254 0.38
255 0.3
256 0.2
257 0.17
258 0.13
259 0.12
260 0.1
261 0.09
262 0.09
263 0.08
264 0.08
265 0.06
266 0.07
267 0.08
268 0.09
269 0.1
270 0.1
271 0.12
272 0.12
273 0.13
274 0.14
275 0.13
276 0.18
277 0.19
278 0.2
279 0.19
280 0.21
281 0.26
282 0.24
283 0.26
284 0.26
285 0.27
286 0.29
287 0.3
288 0.28
289 0.23
290 0.24
291 0.25
292 0.2
293 0.2
294 0.2
295 0.2
296 0.21
297 0.22
298 0.21
299 0.19
300 0.17
301 0.15
302 0.13
303 0.13
304 0.16
305 0.15
306 0.15
307 0.17
308 0.18
309 0.19
310 0.18
311 0.19
312 0.16
313 0.16
314 0.23
315 0.21
316 0.25
317 0.27
318 0.27
319 0.27
320 0.27
321 0.28
322 0.22
323 0.22
324 0.16
325 0.17
326 0.19
327 0.19
328 0.19
329 0.18
330 0.17
331 0.18
332 0.18
333 0.15
334 0.13
335 0.09
336 0.1
337 0.09
338 0.11
339 0.14
340 0.18
341 0.19
342 0.24
343 0.34
344 0.39
345 0.48
346 0.58
347 0.62
348 0.67
349 0.76
350 0.81
351 0.82
352 0.8
353 0.8
354 0.75
355 0.75
356 0.74
357 0.69
358 0.64
359 0.55
360 0.55