Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166HS94

Protein Details
Accession A0A166HS94   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71APTLKVFKRCWKKGARHRPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MVRGVSALLITGRAGERKTAVAKAVAQCMQIDPRVYTHTLHIGHVQPAGTSAPTLKVFKRCWKKGARHRPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.16
5 0.19
6 0.18
7 0.18
8 0.18
9 0.22
10 0.22
11 0.26
12 0.23
13 0.21
14 0.2
15 0.2
16 0.19
17 0.17
18 0.16
19 0.12
20 0.12
21 0.13
22 0.14
23 0.14
24 0.13
25 0.17
26 0.17
27 0.17
28 0.19
29 0.18
30 0.18
31 0.19
32 0.18
33 0.12
34 0.12
35 0.12
36 0.09
37 0.08
38 0.08
39 0.1
40 0.14
41 0.16
42 0.19
43 0.26
44 0.31
45 0.41
46 0.52
47 0.53
48 0.59
49 0.67
50 0.75
51 0.78