Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X929

Protein Details
Accession A0A165X929   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
125-148ETINRHLKKQSRPQTKNKRVAQIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MEMSVESDADAPEEQGADVEEQMDGADEDDDEQDAEPEVDVDRELELDLVPRVHWERLGQRRETDDGALGRASYGREQPHRPRRAVDIVQEEEIADRDQDRAPTPGNPRKHMNLSEKEPEDEKAETINRHLKKQSRPQTKNKRVAQIKATPQSTTKAPTPASASDAGEEDEGDGEDGEKGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.08
5 0.08
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.09
39 0.12
40 0.12
41 0.13
42 0.15
43 0.23
44 0.32
45 0.38
46 0.37
47 0.37
48 0.4
49 0.42
50 0.39
51 0.31
52 0.25
53 0.2
54 0.19
55 0.17
56 0.13
57 0.11
58 0.1
59 0.1
60 0.08
61 0.11
62 0.14
63 0.18
64 0.25
65 0.35
66 0.45
67 0.49
68 0.49
69 0.48
70 0.49
71 0.52
72 0.48
73 0.43
74 0.39
75 0.35
76 0.34
77 0.32
78 0.27
79 0.19
80 0.18
81 0.13
82 0.06
83 0.05
84 0.06
85 0.07
86 0.08
87 0.09
88 0.1
89 0.11
90 0.17
91 0.25
92 0.31
93 0.34
94 0.37
95 0.39
96 0.42
97 0.46
98 0.48
99 0.47
100 0.46
101 0.47
102 0.51
103 0.49
104 0.46
105 0.42
106 0.36
107 0.31
108 0.26
109 0.21
110 0.17
111 0.18
112 0.18
113 0.21
114 0.29
115 0.28
116 0.32
117 0.37
118 0.41
119 0.48
120 0.58
121 0.64
122 0.67
123 0.72
124 0.79
125 0.85
126 0.88
127 0.89
128 0.85
129 0.85
130 0.8
131 0.79
132 0.75
133 0.73
134 0.71
135 0.69
136 0.64
137 0.55
138 0.5
139 0.47
140 0.42
141 0.38
142 0.32
143 0.3
144 0.29
145 0.3
146 0.33
147 0.31
148 0.32
149 0.3
150 0.27
151 0.23
152 0.23
153 0.21
154 0.17
155 0.15
156 0.12
157 0.1
158 0.09
159 0.08
160 0.07
161 0.07
162 0.07