Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5R2L7

Protein Details
Accession E5R2L7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-74NVFERHGRERRRRKEKEEEKMPSBasic
NLS Segment(s)
PositionSequence
56-68RHGRERRRRKEKE
Subcellular Location(s) nucl 15.5, cyto_nucl 10.833, mito 6.5, cyto_mito 6.333, cyto 5
Family & Domain DBs
Amino Acid Sequences MAYQINGISLGSRKDIVSSSRGKPEISRMYHTSLFAYNIRCIVQGKPPTRLNVFERHGRERRRRKEKEEEKMPSILAFLEKREEIRDVWGLEGTSQLHDFYVIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.22
5 0.27
6 0.29
7 0.35
8 0.37
9 0.36
10 0.35
11 0.41
12 0.44
13 0.42
14 0.43
15 0.39
16 0.43
17 0.44
18 0.43
19 0.35
20 0.27
21 0.26
22 0.23
23 0.23
24 0.18
25 0.17
26 0.17
27 0.16
28 0.16
29 0.15
30 0.2
31 0.25
32 0.27
33 0.32
34 0.34
35 0.36
36 0.36
37 0.38
38 0.34
39 0.34
40 0.34
41 0.35
42 0.37
43 0.41
44 0.46
45 0.51
46 0.58
47 0.61
48 0.69
49 0.74
50 0.77
51 0.78
52 0.83
53 0.85
54 0.85
55 0.84
56 0.8
57 0.72
58 0.66
59 0.58
60 0.47
61 0.37
62 0.27
63 0.2
64 0.15
65 0.12
66 0.14
67 0.15
68 0.16
69 0.18
70 0.19
71 0.16
72 0.2
73 0.23
74 0.2
75 0.21
76 0.21
77 0.19
78 0.17
79 0.19
80 0.16
81 0.14
82 0.14
83 0.13
84 0.11