Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V4M2

Protein Details
Accession E4V4M2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
125-147YWDYDKRKSRRVTWGLRNRSKLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MDKYPEGSREWMSEITRLKAAKPCPWTKEQWEASIARRNEPEKPRFIPIVLGGALDTPEKIQEKAGLPEPPKIETTHTVSEFGPPLPPDKQETSDTPNHPPTPPTILIVSNRTFSLSQLREKENYWDYDKRKSRRVTWGLRNRSKLGHKLGICWYYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.33
4 0.31
5 0.31
6 0.33
7 0.36
8 0.38
9 0.43
10 0.47
11 0.49
12 0.53
13 0.56
14 0.56
15 0.61
16 0.57
17 0.51
18 0.49
19 0.45
20 0.45
21 0.47
22 0.42
23 0.36
24 0.38
25 0.37
26 0.41
27 0.47
28 0.48
29 0.46
30 0.48
31 0.49
32 0.45
33 0.44
34 0.37
35 0.29
36 0.27
37 0.2
38 0.17
39 0.12
40 0.11
41 0.11
42 0.09
43 0.08
44 0.04
45 0.07
46 0.08
47 0.09
48 0.09
49 0.12
50 0.14
51 0.17
52 0.2
53 0.22
54 0.22
55 0.27
56 0.27
57 0.25
58 0.24
59 0.22
60 0.21
61 0.2
62 0.23
63 0.23
64 0.22
65 0.22
66 0.21
67 0.22
68 0.21
69 0.18
70 0.14
71 0.1
72 0.13
73 0.12
74 0.13
75 0.15
76 0.17
77 0.2
78 0.21
79 0.24
80 0.27
81 0.33
82 0.34
83 0.36
84 0.38
85 0.37
86 0.35
87 0.33
88 0.29
89 0.29
90 0.27
91 0.24
92 0.2
93 0.21
94 0.22
95 0.26
96 0.25
97 0.2
98 0.19
99 0.2
100 0.18
101 0.17
102 0.24
103 0.22
104 0.28
105 0.32
106 0.35
107 0.35
108 0.36
109 0.42
110 0.37
111 0.38
112 0.38
113 0.41
114 0.41
115 0.5
116 0.58
117 0.57
118 0.62
119 0.64
120 0.65
121 0.68
122 0.75
123 0.74
124 0.76
125 0.81
126 0.83
127 0.85
128 0.83
129 0.75
130 0.74
131 0.71
132 0.68
133 0.66
134 0.63
135 0.56
136 0.55
137 0.6