Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166BPS2

Protein Details
Accession A0A166BPS2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-124AALAAAPKKQKKQKRKQKKLSTEVSVSLHydrophilic
NLS Segment(s)
PositionSequence
102-115APKKQKKQKRKQKK
Subcellular Location(s) nucl 9, cyto_nucl 9, cyto 7, mito 5, extr 3
Family & Domain DBs
Amino Acid Sequences MATTLPTDTLTVTTPDLTAPSPPQEAAWPPHGSTFYYDGLQDDDYFITYPAPCTTFIPVELSDSELRTREKFYAERAVKTAAREAAAALAATALAAAALAAAPKKQKKQKRKQKKLSTEVSVSLKTDEVQAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.13
6 0.14
7 0.16
8 0.17
9 0.17
10 0.17
11 0.19
12 0.22
13 0.23
14 0.26
15 0.25
16 0.23
17 0.26
18 0.26
19 0.24
20 0.24
21 0.23
22 0.19
23 0.18
24 0.18
25 0.15
26 0.16
27 0.16
28 0.13
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.12
42 0.12
43 0.12
44 0.14
45 0.13
46 0.13
47 0.12
48 0.14
49 0.12
50 0.12
51 0.12
52 0.12
53 0.13
54 0.12
55 0.14
56 0.12
57 0.15
58 0.16
59 0.18
60 0.27
61 0.28
62 0.28
63 0.28
64 0.31
65 0.29
66 0.29
67 0.28
68 0.19
69 0.18
70 0.17
71 0.15
72 0.12
73 0.11
74 0.1
75 0.06
76 0.05
77 0.04
78 0.04
79 0.03
80 0.02
81 0.02
82 0.02
83 0.01
84 0.02
85 0.02
86 0.02
87 0.03
88 0.05
89 0.11
90 0.17
91 0.26
92 0.35
93 0.46
94 0.57
95 0.68
96 0.78
97 0.84
98 0.91
99 0.93
100 0.95
101 0.96
102 0.95
103 0.92
104 0.88
105 0.81
106 0.76
107 0.69
108 0.6
109 0.5
110 0.41
111 0.33
112 0.26