Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ARN8

Protein Details
Accession A0A166ARN8    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-127AQTSSRRSSPRRSWTRRTGTRTTRARSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 8, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046342  CBS_dom_sf  
Amino Acid Sequences GLLLVKKLLVYDPAKALPVSAFALSILPEANPNINCFQALDYFQTGRAHLLLISRTPGVAGGAMGVITLEGASPLSPSPPSPICSQRPRMLTAALCVVCCAQTSSRRSSPRRSWTRRTGTRTTRARSAPSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.17
5 0.18
6 0.16
7 0.12
8 0.11
9 0.1
10 0.1
11 0.1
12 0.1
13 0.08
14 0.06
15 0.07
16 0.08
17 0.12
18 0.12
19 0.14
20 0.15
21 0.15
22 0.15
23 0.14
24 0.14
25 0.12
26 0.13
27 0.13
28 0.14
29 0.14
30 0.17
31 0.17
32 0.16
33 0.15
34 0.13
35 0.11
36 0.09
37 0.11
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.08
44 0.08
45 0.06
46 0.05
47 0.05
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.04
63 0.04
64 0.05
65 0.09
66 0.11
67 0.13
68 0.17
69 0.23
70 0.29
71 0.36
72 0.42
73 0.44
74 0.44
75 0.46
76 0.43
77 0.4
78 0.34
79 0.28
80 0.29
81 0.24
82 0.21
83 0.18
84 0.17
85 0.14
86 0.14
87 0.14
88 0.12
89 0.19
90 0.23
91 0.3
92 0.38
93 0.47
94 0.51
95 0.59
96 0.65
97 0.69
98 0.76
99 0.77
100 0.79
101 0.81
102 0.87
103 0.87
104 0.85
105 0.84
106 0.82
107 0.84
108 0.83
109 0.78
110 0.76
111 0.71