Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VDU3

Protein Details
Accession A0A167VDU3   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-45ATMGRKVKQKTYKSKREFRDDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.333, cyto 7, mito 6, cyto_pero 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001487  Bromodomain  
IPR036427  Bromodomain-like_sf  
IPR037782  Spt7  
Gene Ontology GO:0000124  C:SAGA complex  
GO:0046695  C:SLIK (SAGA-like) complex  
Pfam View protein in Pfam  
PF00439  Bromodomain  
PROSITE View protein in PROSITE  
PS50014  BROMODOMAIN_2  
Amino Acid Sequences FLKPVARADVPDYYEVIQTPMDLATMGRKVKQKTYKSKREFRDDLDLIWSNCWTYNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.17
4 0.12
5 0.1
6 0.09
7 0.08
8 0.07
9 0.06
10 0.06
11 0.07
12 0.11
13 0.11
14 0.14
15 0.19
16 0.2
17 0.29
18 0.38
19 0.44
20 0.52
21 0.62
22 0.69
23 0.74
24 0.82
25 0.81
26 0.81
27 0.77
28 0.71
29 0.71
30 0.61
31 0.53
32 0.5
33 0.47
34 0.37
35 0.35
36 0.3
37 0.2